Entry information : PtPrx89 (POPTR_0015s00580)
Entry ID 3206
Creation 2006-06-14 (Claudia Cosio)
Last sequence changes 2006-06-14 (Claudia Cosio)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrx89 (POPTR_0015s00580)
Name (synonym) PtPrx89 (POPTR_0015s00580)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx89
start..stop
S start..stop
PnPrx89 598 0 3..329 1..327
PatrPrx10 547 0 2..329 1..329
PtPrx90 529 0 3..329 1..330
PnPrx90 521 0 3..329 1..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 353667..353888 222 N° 2 353235..353426 192 N° 3 352966..353128 163 N° 4 352469..352881 413
complement(join(352469..352881,352966..353128,353235..353426,353667..353888))


exon

Literature and cross-references PtPrx89 (POPTR_0015s00580)
Literature DOE joint genome institute.
DNA ref. Phytozome 12:   scaffold_15 (353888..352469)
Cluster/Prediction ref. JGI gene:   87887
Omic ref. ePlant:   Potri.015G003500
Protein sequence: PtPrx89 (POPTR_0015s00580)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (302)
PWM (Da):   %s   35592.68 (32564.2)  
PI (pH):   %s   7.88 (7.31) Peptide Signal:   %s   cut: 28 range:28-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMMSSKKLTQLSVICWVAVLFCQSVQSQLQVGFYRNSCRRAELIVRNAVRDGINKDRGVAAGLVRMHFHDCFVRGCEGSVLLDSTSSNTAEKDSPANNPSLRGYEVVDDARAKLEAECRGVVSCADILAFAARDSFDLTGGISYDVPAGRRDGTVSLVAETSDLPPPTLNVDQLTQNFAKKGLSQEEMVTLSGGHTIGRSHCTSFRDRLYNFSGTNSQDPSLDATYAASLKQKCPQASTDTNLVVPMDTITPTISDVSYYRDILANRGLFTSDQTLLSNTATASQVNSNSRSPLGWKRKFAAAMVKMGQIEVLTGNTGEIRANCRVINS

Retrieve as FASTA  
Remarks From genomic DNA (3 introns). No EST. Contig contains PtPrx90.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGATGAGTTCCAAGAAGCTAACTCAGCTATCTGTCATTTGTTGGGTGGCTGTTTTGTTTTGTCAAAGTGTCCAATCTCAGCTTCAAGTAGGGTTTTATAGAAATTCATGCAGGAGG
GCTGAGTTGATTGTTAGAAATGCTGTTAGAGATGGTATCAACAAGGATAGAGGTGTAGCTGCTGGCCTTGTGAGAATGCACTTTCATGACTGTTTTGTTAGG
GTACGTAAGCATAAGCTA
GCTAGCACACACTCGAGAAAAGTTATTTTCTAGCCAAAAAAACACATGACAGACACATTTAAATTAATCATAACATGATCCAAAAAGCTTAAAGTAATTATTAACATGTTTTTGCAACGG
CAACCCTAGGTTGCCTTAATCGGTGTAAGCATGTAAACTTTTTTGCTTGTTCGAAGGTTATTAACCTGGTTAGATGTGTTTCTTTCTTTTTTACTAATGTAGGGTTGTGAAGGTTCTGTG
CTTCTCGACTCCACCTCATCAAACACAGCAGAAAAGGACTCTCCTGCCAACAACCCTAGTCTGCGTGGTTATGAAGTCGTCGACGATGCAAGGGCTAAACTAGAAGCCGAATGTCGAGGA
GTCGTTTCATGTGCTGATATTCTGGCATTTGCAGCAAGGGATAGCTTTGATTTA
GTAAGTAGAAACGTTAATTAATTTGGCTTAGCATTTGTGGATTGTTTAGGAAACTGAAGTGGTATG
TGACATGCTTCAACCTTGAACCCTTTCATTATTCGTGCAGACTGGAGGGATTAGCTATGATGTTCCGGCTGGAAGAAGAGATGGCACAGTTTCGCTAGTCGCAGAGACTTCAGACTTACC
TCCTCCCACCTTAAATGTTGATCAACTCACTCAAAACTTTGCAAAGAAGGGTTTATCACAAGAAGAAATGGTCACACTATCCG
GTAGTATAATTAATTAACCTCGAATCAATCTCACTCT
TCTAAGACAAGATCATTAACAACTTACTAATTACTGCATGTTAACAGGAGGACATACCATCGGTCGTTCACATTGCACTTCCTTCAGAGATAGATTATACAACTTCAGTGGAACAAATAG
CCAAGACCCAAGCTTGGATGCCACATATGCAGCCAGTTTGAAGCAGAAGTGCCCACAAGCTAGTACAGATACTAACTTGGTGGTGCCAATGGACACTATTACTCCAACCATTAGTGATGT
AAGTTACTACAGAGATATCCTAGCAAACCGAGGCTTGTTCACATCAGATCAAACTCTCTTGTCAAACACAGCAACAGCAAGTCAAGTGAATTCGAATTCGAGGAGTCCCTTAGGCTGGAA
GAGAAAGTTTGCTGCAGCAATGGTAAAAATGGGCCAAATTGAAGTTTTGACTGGTAACACAGGAGAGATTAGGGCAAACTGTAGGGTGATCAACAGCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGATGAGTTCCAAGAAGCTAACTCAGCTATCTGTCATTTGTTGGGTGGCTGTTTTGTTTTGTCAAAGTGTCCAATCTCAGCTTCAAGTAGGGTTTTATAGAAATTCATGCAGGAGG
GCTGAGTTGATTGTTAGAAATGCTGTTAGAGATGGTATCAACAAGGATAGAGGTGTAGCTGCTGGCCTTGTGAGAATGCACTTTCATGACTGTTTTGTTAGG
GGTTGTGAAGGTTCTGTG
CTTCTCGACTCCACCTCATCAAACACAGCAGAAAAGGACTCTCCTGCCAACAACCCTAGTCTGCGTGGTTATGAAGTCGTCGACGATGCAAGGGCTAAACTAGAAGCCGAATGTCGAGGA
GTCGTTTCATGTGCTGATATTCTGGCATTTGCAGCAAGGGATAGCTTTGATTTA
ACTGGAGGGATTAGCTATGATGTTCCGGCTGGAAGAAGAGATGGCACAGTTTCGCTAGTCGCAGAG
ACTTCAGACTTACCTCCTCCCACCTTAAATGTTGATCAACTCACTCAAAACTTTGCAAAGAAGGGTTTATCACAAGAAGAAATGGTCACACTATCCG
GAGGACATACCATCGGTCGTTCA
CATTGCACTTCCTTCAGAGATAGATTATACAACTTCAGTGGAACAAATAGCCAAGACCCAAGCTTGGATGCCACATATGCAGCCAGTTTGAAGCAGAAGTGCCCACAAGCTAGTACAGAT
ACTAACTTGGTGGTGCCAATGGACACTATTACTCCAACCATTAGTGATGTAAGTTACTACAGAGATATCCTAGCAAACCGAGGCTTGTTCACATCAGATCAAACTCTCTTGTCAAACACA
GCAACAGCAAGTCAAGTGAATTCGAATTCGAGGAGTCCCTTAGGCTGGAAGAGAAAGTTTGCTGCAGCAATGGTAAAAATGGGCCAAATTGAAGTTTTGACTGGTAACACAGGAGAGATT
AGGGCAAACTGTAGGGTGATCAACAGCTAA

Retrieve as FASTA