Entry information : PtPrx90 (POPTR_0015s00590 / Potri.015G003600)
Entry ID 3207
Creation 2006-06-12 (Claudia Cosio)
Last sequence changes 2006-06-12 (Claudia Cosio)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrx90 (POPTR_0015s00590 / Potri.015G003600)
Name (synonym) PtPrx90 (POPTR_0015s00590 / Potri.015G003600)
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx90
start..stop
S start..stop
PnPrx90 669 0 1..330 1..329
PtPrx89 529 0 1..330 3..329
MePrx120 509 0 4..330 5..331
CclPrx110 501 2e-180 15..329 15..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 252441..252662 222 N° 2 252020..252211 192 N° 3 251773..251938 166 N° 4 251250..251662 413
complement(join(251250..251662,251773..251938,252020..252211,252441..252662))


exon

Literature and cross-references PtPrx90 (POPTR_0015s00590 / Potri.015G003600)
Literature DOE joint genome institute.
DNA ref. Phytozome 12:   Chr15 (252662..251250)
Cluster/Prediction ref. JGI gene:   574645
Omic ref. ePlant:   Potri.015G003600
Protein sequence: PtPrx90 (POPTR_0015s00590 / Potri.015G003600)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (303)
PWM (Da):   %s   35619.58 (32541.0)  
PI (pH):   %s   7.85 (6.88) Peptide Signal:   %s   cut: 28 range:28-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSKKLSRPCLVCWVVVFLFCNQSVHSQLEVGFYRSSCKMAEFIVKSAVRDGFNKDRGVAAGLVRMHFHDCFVRGCDASVLLDSTTSNKAEKDSPANNPSLRGFEVIDNAKARLETECKGIVSCADILAFAARDSIEITGGFGYDVPAGRRDGTVSLASEVLTNLPPPTFNVDQLTQNFANKGFSQEEMVTLSGGHTIGRSHCTSFSNRLYNFNGTTSQDPILDATYATSLKQMCPQGSTDPSLVVPMNPGSPATTDAGYYLDILANRGLFTSDQTLLTNAATATQVNINARNSMLWKRKFAAAMQKMGKLDVLTGNAGEIRADCRVINS

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (3 introns). ESTs from various populus hybrid. Contig contains PtPrx89.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTTCCAAGAAGCTAAGTCGGCCATGTCTAGTTTGCTGGGTTGTTGTTTTCCTGTTCTGTAATCAAAGTGTTCATTCTCAGCTTGAAGTAGGGTTTTATAGAAGTTCATGCAAGATG
GCTGAGTTCATTGTCAAAAGTGCAGTTAGAGATGGTTTCAATAAGGATAGAGGAGTGGCTGCTGGTCTTGTTAGAATGCACTTTCATGATTGTTTCGTTAGG
GTAAGTATGTGTGTGTGT
GTGTGTGTGTGTGTGTAGAGAGAGACAGAGATGTGAACAAGTAAACATAATCTCTTCTTCTTTACTTCAAAGAAGCAAAAAGAGGAACCTTGGAAGTATTTCAAAGGAAAAAAATTAACT
AAGTTCATATCACTATAGCGCGTGGGTTTTAGATCTAATTCATGACAGTGCTTGATTAGACACTAACTTGGTTACCCTTTTGGTCATTTAGGGCTGTGATGCATCTGTGCTCCTTGACTC
CACTACCTCAAACAAAGCAGAAAAAGACTCTCCTGCCAACAACCCTAGTCTGCGAGGCTTTGAAGTCATTGACAATGCAAAGGCTAGACTAGAGACCGAATGCAAGGGAATTGTCTCATG
TGCTGATATTCTCGCATTTGCAGCAAGAGATAGCATTGAGATA
GTAAGAAGAATTGTTTATGAAGTGTTAAACGCGCATGCTTCAGCATGCATGTATATATATAACCCTTAATTCTTTGT
GCAGACTGGAGGTTTTGGCTATGATGTTCCTGCGGGAAGAAGAGATGGCACAGTTTCACTAGCTTCAGAGGTCTTAACAAACTTACCTCCCCCCACATTCAATGTCGACCAACTCACTCA
AAATTTTGCAAACAAGGGTTTCTCACAAGAAGAAATGGTTACCCTCTCTG
GTACTTTACCTATATTTACTATATCCTGTCAAAACAAGATTAATTCTTACCAAATTAAATCTCGACACTG
CTGAATGATCATAATAAACTCTGTGATGATATACATCCAGGAGGACACACCATCGGTCGATCACATTGCACTTCCTTCAGCAACAGATTATACAACTTCAATGGAACAACGAGCCAGGAC
CCAATCTTAGATGCTACGTATGCAACAAGTTTGAAGCAGATGTGTCCGCAAGGCAGTACAGATCCTAGCCTGGTGGTGCCAATGAACCCTGGTAGTCCAGCCACTACTGATGCAGGCTAC
TATCTCGATATCTTAGCAAACCGAGGCTTGTTCACATCAGACCAAACTCTCTTGACAAATGCAGCAACTGCAACTCAAGTGAATATTAATGCAAGAAATTCCATGCTTTGGAAGAGAAAG
TTTGCAGCTGCCATGCAGAAGATGGGCAAACTTGATGTCTTGACCGGGAATGCGGGAGAGATTCGGGCTGATTGTAGGGTCATCAACAGTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTTCCAAGAAGCTAAGTCGGCCATGTCTAGTTTGCTGGGTTGTTGTTTTCCTGTTCTGTAATCAAAGTGTTCATTCTCAGCTTGAAGTAGGGTTTTATAGAAGTTCATGCAAGATG
GCTGAGTTCATTGTCAAAAGTGCAGTTAGAGATGGTTTCAATAAGGATAGAGGAGTGGCTGCTGGTCTTGTTAGAATGCACTTTCATGATTGTTTCGTTAGG
GGCTGTGATGCATCTGTG
CTCCTTGACTCCACTACCTCAAACAAAGCAGAAAAAGACTCTCCTGCCAACAACCCTAGTCTGCGAGGCTTTGAAGTCATTGACAATGCAAAGGCTAGACTAGAGACCGAATGCAAGGGA
ATTGTCTCATGTGCTGATATTCTCGCATTTGCAGCAAGAGATAGCATTGAGATA
ACTGGAGGTTTTGGCTATGATGTTCCTGCGGGAAGAAGAGATGGCACAGTTTCACTAGCTTCAGAG
GTCTTAACAAACTTACCTCCCCCCACATTCAATGTCGACCAACTCACTCAAAATTTTGCAAACAAGGGTTTCTCACAAGAAGAAATGGTTACCCTCTCTG
GAGGACACACCATCGGTCGA
TCACATTGCACTTCCTTCAGCAACAGATTATACAACTTCAATGGAACAACGAGCCAGGACCCAATCTTAGATGCTACGTATGCAACAAGTTTGAAGCAGATGTGTCCGCAAGGCAGTACA
GATCCTAGCCTGGTGGTGCCAATGAACCCTGGTAGTCCAGCCACTACTGATGCAGGCTACTATCTCGATATCTTAGCAAACCGAGGCTTGTTCACATCAGACCAAACTCTCTTGACAAAT
GCAGCAACTGCAACTCAAGTGAATATTAATGCAAGAAATTCCATGCTTTGGAAGAGAAAGTTTGCAGCTGCCATGCAGAAGATGGGCAAACTTGATGTCTTGACCGGGAATGCGGGAGAG
ATTCGGGCTGATTGTAGGGTCATCAACAGTTAG

Retrieve as FASTA