Entry information : BfuCcP01 (BotryofCcP)
Entry ID 3214
Creation 2006-08-30 (Marcel Zamocky)
Last sequence changes 2006-08-30 (Marcel Zamocky)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-26 (Christophe Dunand)
Peroxidase information: BfuCcP01 (BotryofCcP)
Name (synonym) BfuCcP01 (BotryofCcP)
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Ascomycota Leotiomycetes Sclerotiniaceae Botryotinia
Organism Botryotinia fuckeliana (Botrytis cinerea Sclerotinia fuckeliana)    [TaxId: 40559 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BfuCcP01
start..stop
S start..stop
SsclCcP01 639 0 1..325 1..324
MvarCcP02 573 0 1..325 1..324
AresCcP01 572 0 1..325 1..324
AmacrCcP02 567 0 1..325 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7515..7624 110 N° 2 7728..8595 868  
join(7515..7624,7728..8595)


exon

Literature and cross-references BfuCcP01 (BotryofCcP)
Literature Amedeo, P. et al. "The genome sequence of Botryotinia fuckeliana B05.10" unpublished
Zamocky, M. "Divergent evolutionary lines of cytochrome c peroxidases" (in preparation 2006)
DNA ref. JGI genome:   Supercontig_1.91 (7515..8595)
Protein sequence: BfuCcP01 (BotryofCcP)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325
PWM (Da):   %s   36280.08  
PI (pH):   %s   6.33
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSKKGDFAAVRKDIVGLLHQPEYDDGSAGPVLVRLAWHSAGTYDSETDTGGSNGAGMRYESEGGDPANAGLQHARVFLEPVKAKHPWITYADLWTLAGVVAIKEMGGPDIPWQGGRTDYVDDSKLPPRGRLPDAAQGSDHLRWIFYRMGFDDQEIVALSGAHNLGRCHSDRSGFEGAWVNNPTRFSNQYYRLLLSLQWRKKKLPNGIEQFVNYDEDTETELMMLPTDLALTQDKEFKRWVGKYADDKEKFFEDFSKVFSKLIELGIRRDSKGNITNLDNEKGGYHSAPKKKDTPGSPAKNTDDKKVNVSEAAPLQEENKKFNSKL

Retrieve as FASTA  
Remarks Complete sequence from 1 genomic (1 intron). Strain="B05.10".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTAAGAAAGGGGATTTTGCCGCCGTCCGAAAGGATATTGTTGGCCTTTTACACCAACCGGAATATGATGATGGCAGTGCTGGACCAGTTCTTGTGCGCTTAGCATGGTATGTGGTC
TTTTACTCAATTTCCTTTCCAGACTGTGCGCAGTCAATGCAATCCCTCTCGGCGCAAACGATTCCTTTCTGTTCACAAACTAATATCATCTAGGCATTCGGCCGGAACATACGATTCTGA
GACAGACACTGGTGGATCCAATGGAGCTGGCATGCGATACGAGAGTGAAGGAGGAGATCCAGCAAATGCTGGTCTACAACACGCGCGAGTCTTCCTCGAACCAGTCAAAGCAAAGCACCC
CTGGATAACATATGCGGATCTATGGACATTAGCAGGAGTCGTGGCGATTAAAGAGATGGGTGGACCAGATATCCCATGGCAAGGTGGACGAACAGATTACGTTGATGATTCGAAATTGCC
CCCGCGAGGACGTCTACCAGATGCAGCACAAGGTTCCGATCATCTTCGATGGATTTTCTACCGCATGGGATTTGATGATCAGGAAATCGTTGCGTTGAGTGGAGCTCATAATCTGGGACG
ATGCCACAGCGATCGATCTGGTTTCGAAGGAGCTTGGGTTAATAATCCCACGAGATTCTCGAATCAATATTACAGACTTTTGCTTTCCCTTCAGTGGCGCAAGAAGAAGTTGCCAAATGG
AATCGAACAATTTGTCAACTATGACGAGGATACCGAGACGGAATTGATGATGCTTCCAACGGATTTGGCTCTGACGCAAGATAAGGAGTTCAAGCGATGGGTCGGAAAATATGCAGATGA
TAAGGAGAAGTTCTTTGAAGATTTCAGTAAAGTCTTTTCGAAGCTGATCGAGTTGGGTATTCGAAGAGATAGCAAGGGTAATATTACAAATTTGGATAATGAAAAGGGCGGATATCATTC
AGCGCCAAAGAAGAAGGATACTCCTGGTAGTCCAGCGAAGAACACAGATGATAAGAAAGTGAATGTTAGCGAGGCGGCTCCATTGCAGGAGGAGAACAAGAAGTTCAACTCGAAGTTGTA
G

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTAAGAAAGGGGATTTTGCCGCCGTCCGAAAGGATATTGTTGGCCTTTTACACCAACCGGAATATGATGATGGCAGTGCTGGACCAGTTCTTGTGCGCTTAGCATGGCATTCGGCC
GGAACATACGATTCTGAGACAGACACTGGTGGATCCAATGGAGCTGGCATGCGATACGAGAGTGAAGGAGGAGATCCAGCAAATGCTGGTCTACAACACGCGCGAGTCTTCCTCGAACCA
GTCAAAGCAAAGCACCCCTGGATAACATATGCGGATCTATGGACATTAGCAGGAGTCGTGGCGATTAAAGAGATGGGTGGACCAGATATCCCATGGCAAGGTGGACGAACAGATTACGTT
GATGATTCGAAATTGCCCCCGCGAGGACGTCTACCAGATGCAGCACAAGGTTCCGATCATCTTCGATGGATTTTCTACCGCATGGGATTTGATGATCAGGAAATCGTTGCGTTGAGTGGA
GCTCATAATCTGGGACGATGCCACAGCGATCGATCTGGTTTCGAAGGAGCTTGGGTTAATAATCCCACGAGATTCTCGAATCAATATTACAGACTTTTGCTTTCCCTTCAGTGGCGCAAG
AAGAAGTTGCCAAATGGAATCGAACAATTTGTCAACTATGACGAGGATACCGAGACGGAATTGATGATGCTTCCAACGGATTTGGCTCTGACGCAAGATAAGGAGTTCAAGCGATGGGTC
GGAAAATATGCAGATGATAAGGAGAAGTTCTTTGAAGATTTCAGTAAAGTCTTTTCGAAGCTGATCGAGTTGGGTATTCGAAGAGATAGCAAGGGTAATATTACAAATTTGGATAATGAA
AAGGGCGGATATCATTCAGCGCCAAAGAAGAAGGATACTCCTGGTAGTCCAGCGAAGAACACAGATGATAAGAAAGTGAATGTTAGCGAGGCGGCTCCATTGCAGGAGGAGAACAAGAAG
TTCAACTCGAAGTTGTAG

Retrieve as FASTA