Entry information : PtPrx95 (POPTR_0008s11000 / PT08G10250 / Potri.008G110600)
Entry ID 3216
Creation 2010-01-15 (Christophe Dunand)
Last sequence changes 2010-06-17 (Marie Brette (Scipio))
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrx95 (POPTR_0008s11000 / PT08G10250 / Potri.008G110600)
Name (synonym) PtPrx95 (POPTR_0008s11000 / PT08G10250 / Potri.008G110600)
Class Class III peroxidase    [Orthogroup: Prx025]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx95
start..stop
S start..stop
PtPrx92 624 0 1..340 1..341
MePrx128 564 0 27..340 28..342
MePrx12 561 0 4..340 5..340
VvPrx48 535 0 26..340 25..339
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6931016..6931255 240 N° 2 6930689..6930880 192 N° 3 6930406..6930571 166 N° 4 6929864..6930288 425
complement(join(6929864..6930288,6930406..6930571,6930689..6930880,6931016..6931 255))


exon

Literature and cross-references PtPrx95 (POPTR_0008s11000 / PT08G10250 / Potri.008G110600)
DNA ref. Phytozome 12:   scaffold_8 (6931255..6929864)
Omic ref. ePlant:   Potri.008G110600
Protein sequence: PtPrx95 (POPTR_0008s11000 / PT08G10250 / Potri.008G110600)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   340
PWM (Da):   %s   37064.69  
PI (pH):   %s   4.82
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFPLQEIKLPILPFSMLIIISILGRSLHASGPPLTLDYYAPTCPSVFEIVKKEMECEVISDPRSAALIVRLHFHDCFVQGCDGSVLLDDTITLQGEKKASTNINSLEGFKIIDRIKNKIESECPGIVSCADILTIAARDAVLLVGGPYWDVPVGRKDSKTASFELAASNIPTADEGLLSIITKFLYQGLSVTDLVALSGAHTIGMAHCANFRARIYGDFETTSDRSPVSETYLNNLKSMCPATGGGDNNISAMDYVTPNLFDNSFYHLLLKGDGLLNSDQELYSSILGLETKNLVIKYAHDPIAFFHQFSDSMVKMGNITNPDSFVDGEIRTNCRFVNT

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, 3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTTCCTCTTCAAGAAATAAAGCTTCCCATATTACCATTTTCTATGTTGATTATCATCTCCATCCTCGGCAGAAGCTTGCATGCAAGCGGCCCTCCTCTAACTTTAGACTACTAT
GCTCCCACCTGCCCCAGTGTGTTTGAGATTGTCAAGAAAGAGATGGAATGTGAAGTTATTTCTGATCCACGCAGTGCAGCTTTGATAGTTAGATTACATTTCCATGACTGTTTTGTTCAG
GTTCACAACTCTCAACTTTTGGCATTATCATTGAGTTTCTGCAACTCTAATATCCTTCCCTGTATATACAATAGTACTCCAAGTTATAAATCCTATCTAGCCAACTGATAGGGTATGTTC
CAATTATTGGTGCAGGGATGTGATGGTTCAGTTTTGCTAGATGACACAATCACCCTGCAAGGGGAAAAGAAAGCTTCAACAAACATAAACTCTCTAGAAGGATTTAAAATCATTGATAGA
ATTAAGAACAAGATCGAGTCCGAGTGCCCCGGAATAGTGTCTTGTGCAGATATTCTCACCATTGCAGCAAGAGATGCAGTCCTTCTG
GTACTAAACTGTTCAGCATTACTAGCTAATAGT
AGTAGTAGAATAGATTCATACTTTTGCTAGTTTGAGAAAATTCGGTCTCTTCCTCTCCTTTTCAACCAGTTATAATATTGGCAGGTTGGTGGACCATATTGGGATGTTCCTGTTGGAAGA
AAAGATTCTAAAACTGCAAGTTTCGAGCTCGCGGCATCAAATATTCCAACAGCAGATGAGGGTCTGCTATCTATCATTACCAAGTTTCTTTACCAAGGCCTTTCTGTTACTGATTTGGTA
GCTCTTTCAG
GTAGGATGCTCCTATGGTGGGAGGGACATTGACCCTGCATATAACTACTACTTGAAAACTCATAAGAACATTGCATTTCTAATATTTAAAATCCATTCCTGTCTGTGAAA
TCTGCAGGGGCGCACACTATTGGCATGGCACACTGTGCAAATTTTCGGGCGAGGATTTACGGGGACTTTGAAACAACTTCGGATAGAAGTCCAGTGTCTGAGACATATCTTAACAACTTG
AAATCTATGTGCCCAGCTACAGGAGGAGGGGACAATAACATATCAGCAATGGACTATGTCACGCCTAATCTTTTCGACAACTCTTTCTATCATTTACTATTGAAAGGAGATGGCCTGCTA
AACTCAGACCAAGAACTGTACTCGAGCATACTCGGACTTGAAACAAAGAATCTTGTGATAAAGTATGCCCATGATCCAATTGCTTTCTTTCACCAATTCTCAGATTCCATGGTGAAAATG
GGAAACATTACAAATCCTGATAGCTTTGTCGATGGAGAAATTAGGACGAACTGCAGATTTGTGAACACATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTTCCTCTTCAAGAAATAAAGCTTCCCATATTACCATTTTCTATGTTGATTATCATCTCCATCCTCGGCAGAAGCTTGCATGCAAGCGGCCCTCCTCTAACTTTAGACTACTAT
GCTCCCACCTGCCCCAGTGTGTTTGAGATTGTCAAGAAAGAGATGGAATGTGAAGTTATTTCTGATCCACGCAGTGCAGCTTTGATAGTTAGATTACATTTCCATGACTGTTTTGTTCAG
GGATGTGATGGTTCAGTTTTGCTAGATGACACAATCACCCTGCAAGGGGAAAAGAAAGCTTCAACAAACATAAACTCTCTAGAAGGATTTAAAATCATTGATAGAATTAAGAACAAGATC
GAGTCCGAGTGCCCCGGAATAGTGTCTTGTGCAGATATTCTCACCATTGCAGCAAGAGATGCAGTCCTTCTG
GTTGGTGGACCATATTGGGATGTTCCTGTTGGAAGAAAAGATTCTAAA
ACTGCAAGTTTCGAGCTCGCGGCATCAAATATTCCAACAGCAGATGAGGGTCTGCTATCTATCATTACCAAGTTTCTTTACCAAGGCCTTTCTGTTACTGATTTGGTAGCTCTTTCAG
GG
GCGCACACTATTGGCATGGCACACTGTGCAAATTTTCGGGCGAGGATTTACGGGGACTTTGAAACAACTTCGGATAGAAGTCCAGTGTCTGAGACATATCTTAACAACTTGAAATCTATG
TGCCCAGCTACAGGAGGAGGGGACAATAACATATCAGCAATGGACTATGTCACGCCTAATCTTTTCGACAACTCTTTCTATCATTTACTATTGAAAGGAGATGGCCTGCTAAACTCAGAC
CAAGAACTGTACTCGAGCATACTCGGACTTGAAACAAAGAATCTTGTGATAAAGTATGCCCATGATCCAATTGCTTTCTTTCACCAATTCTCAGATTCCATGGTGAAAATGGGAAACATT
ACAAATCCTGATAGCTTTGTCGATGGAGAAATTAGGACGAACTGCAGATTTGTGAACACATGA

Retrieve as FASTA