Entry information : SsclCcP01 (ScleroCcP1)
Entry ID 3247
Creation 2006-08-11 (Marcel Zamocky)
Last sequence changes 2006-08-11 (Marcel Zamocky)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-06-06 (Christophe Dunand)
Peroxidase information: SsclCcP01 (ScleroCcP1)
Name (synonym) SsclCcP01 (ScleroCcP1)
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Ascomycota Leotiomycetes Sclerotiniaceae Sclerotinia
Organism Sclerotinia sclerotiorum    [TaxId: 5180 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsclCcP01
start..stop
S start..stop
BfuCcP01 639 0 1..324 1..325
AresCcP01 585 0 1..324 1..324
MvarCcP02 579 0 1..324 1..324
AmacrCcP02 576 0 1..324 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 235399..235508 110 N° 2 234432..235296 865  
complement(join(234432..235296,235399..235508))


exon

Literature and cross-references SsclCcP01 (ScleroCcP1)
Literature Zamocky M. Divergent evolutionary lines of cytochrome c peroxidases 2006 (in preparation).
Lander E. et al. The genome sequence of Sclerotinia sclerotiorum 1980 (unpublished)
DNA ref. JGI genome:   Supercontig_2.14 (235508..234432)
Protein sequence: SsclCcP01 (ScleroCcP1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324
PWM (Da):   %s   35924.86  
PI (pH):   %s   5.67
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSKKGDFAAVSKDIVGLLHQPEYDDGSAGPVLVRLAWHSAGTYDAETDTGGSNGAGMRYESEGGDPANAGLQHARVFLEPVKAKHPWITYADLWTLAGVVAIKEMGGPEIPWKGGRTDYVDDSKLPPRGRLPDAAQGSDHLRWIFYRMGFNDQEIVALSGAHNLGRCHSDRSGFEGAWVNNPTRFSNQYYRLLLSLQWRKKKLPNGIEQFVNYDEDTETELMMLPTDLALTQDKEFKKWVGKYADDKEKFFEDFSKVFAKLIELGIQRDGEGNITNLDNEKGGYHSAPKKKDTPGSPAKSSDDKVDVSEAEPLKEGNKKFNSKL

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTAAGAAAGGGGATTTTGCTGCCGTCAGTAAGGACATTGTCGGTCTTTTACACCAACCGGAATACGATGATGGCAGTGCTGGACCTGTTCTTGTGCGCTTAGCATGGTATGTGAAC
TTCCAATCCACGTCTCTTCCAGGCTGTGCGCAGCTGCTGCAATCCACTTGGGCGCATCTACTCCCTTCAATTCACAAATTAACATCTTCTAGGCACTCTGCTGGAACATACGATGCTGAG
ACAGATACCGGTGGATCCAATGGAGCTGGTATGCGATATGAAAGTGAAGGAGGTGATCCAGCAAATGCTGGTCTACAACATGCAAGAGTATTTCTCGAACCAGTCAAAGCCAAGCACCCC
TGGATAACATATGCGGATCTTTGGACACTGGCCGGAGTTGTGGCAATTAAAGAAATGGGTGGTCCAGAAATTCCATGGAAAGGGGGACGAACGGATTATGTTGATGATTCGAAATTGCCT
CCACGAGGACGTCTACCAGACGCGGCACAAGGCTCTGATCATCTGCGATGGATCTTCTACCGCATGGGCTTTAATGATCAAGAAATAGTTGCCTTGAGTGGAGCACATAATCTTGGACGA
TGTCATAGCGATCGATCCGGATTTGAGGGAGCTTGGGTTAACAATCCTACGAGATTTTCGAATCAATATTACAGACTCTTGCTTTCACTACAATGGCGCAAGAAGAAGTTGCCTAATGGA
ATTGAACAATTCGTCAACTATGACGAGGATACCGAGACGGAATTGATGATGCTACCAACCGATTTGGCCCTCACACAAGATAAGGAGTTCAAGAAATGGGTAGGGAAATATGCAGATGAC
AAGGAGAAGTTCTTTGAGGATTTCAGTAAAGTCTTTGCAAAGTTAATTGAACTGGGCATTCAAAGAGACGGAGAAGGCAATATCACGAACCTAGACAATGAAAAGGGTGGATATCATTCG
GCACCAAAGAAGAAGGATACTCCTGGTAGTCCAGCGAAGAGTTCAGATGACAAGGTGGACGTGAGTGAAGCAGAGCCATTGAAGGAGGGGAATAAGAAGTTCAACTCGAAGCTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTAAGAAAGGGGATTTTGCTGCCGTCAGTAAGGACATTGTCGGTCTTTTACACCAACCGGAATACGATGATGGCAGTGCTGGACCTGTTCTTGTGCGCTTAGCATGGCACTCTGCT
GGAACATACGATGCTGAGACAGATACCGGTGGATCCAATGGAGCTGGTATGCGATATGAAAGTGAAGGAGGTGATCCAGCAAATGCTGGTCTACAACATGCAAGAGTATTTCTCGAACCA
GTCAAAGCCAAGCACCCCTGGATAACATATGCGGATCTTTGGACACTGGCCGGAGTTGTGGCAATTAAAGAAATGGGTGGTCCAGAAATTCCATGGAAAGGGGGACGAACGGATTATGTT
GATGATTCGAAATTGCCTCCACGAGGACGTCTACCAGACGCGGCACAAGGCTCTGATCATCTGCGATGGATCTTCTACCGCATGGGCTTTAATGATCAAGAAATAGTTGCCTTGAGTGGA
GCACATAATCTTGGACGATGTCATAGCGATCGATCCGGATTTGAGGGAGCTTGGGTTAACAATCCTACGAGATTTTCGAATCAATATTACAGACTCTTGCTTTCACTACAATGGCGCAAG
AAGAAGTTGCCTAATGGAATTGAACAATTCGTCAACTATGACGAGGATACCGAGACGGAATTGATGATGCTACCAACCGATTTGGCCCTCACACAAGATAAGGAGTTCAAGAAATGGGTA
GGGAAATATGCAGATGACAAGGAGAAGTTCTTTGAGGATTTCAGTAAAGTCTTTGCAAAGTTAATTGAACTGGGCATTCAAAGAGACGGAGAAGGCAATATCACGAACCTAGACAATGAA
AAGGGTGGATATCATTCGGCACCAAAGAAGAAGGATACTCCTGGTAGTCCAGCGAAGAGTTCAGATGACAAGGTGGACGTGAGTGAAGCAGAGCCATTGAAGGAGGGGAATAAGAAGTTC
AACTCGAAGCTATAA

Retrieve as FASTA