Entry information : SsclCcP02
Entry ID 3251
Creation 2006-08-11 (Christophe Dunand)
Last sequence changes 2006-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-07-16 (Christophe Dunand)
Peroxidase information: SsclCcP02
Name SsclCcP02
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Leotiomycetes Sclerotiniaceae Sclerotinia
Organism Sclerotinia sclerotiorum    [TaxId: 5180 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsclCcP02
start..stop
S start..stop
BfuCcP02 701 0 1..371 1..370
MbicCcP02 629 0 1..371 1..372
MvarCcP01 604 0 1..371 1..373
AmacrCcP01 603 0 1..370 1..367
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 684471..684999 529 N° 2 685146..685519 374 N° 3 685591..685806 216  
join(684471..684999,685146..685519,685591..685806)


exon

Literature and cross-references SsclCcP02
Literature Lander,E., Birren,B., Cuomo,C., Dickman,M., Rollins,J. and Kohn,L.
CONSRTM The Genome Sequencing Platform, The Genome Assembly Team. The Genome Sequence of Sclerotinia sclerotiorum 1980, Unpublished
DNA ref. JGI genome:   Supercontig_2.22 (684471..685806)
Protein sequence: SsclCcP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   372
PWM (Da):   %s   40598.23 Transmb domain:   %s   i52-74o
PI (pH):   %s   9.31
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASTTRTFARAGAAFKSTPFRSATRTNAFSAPRQAFRQQSRRGYASQGPAKSSFPLSVGVAALAIAGGAGYYFVSQGNGSLLSGSAKETAGLITPKFEDYQKVYNEIAARLEEKDDYDDGSYGPVLVRLAWHASGTFDKATGTGGSNGATMRFAPEGDHGANAGLVAARDFLQPVKAKFPWISYSDLWILAGICAIQEMQGPTIPFRPGRQDKEAAACTPDGRLPDASQGNKHLRDIFGRMGFNDQEIVALSGAHALGRCHTDRSGFEGPWTFSPTVVTNEYYKLLLNEKWNWKKWNGPKYEDKTTKTLMMLPTDMALVSDKTFRSYVEKYAADESLFMKDFANVITKLFELGVPFAETTEQGPMKFKPTA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCTACTACTCGAACCTTCGCTAGGGCAGGCGCTGCATTCAAGTCAACACCTTTCAGATCCGCCACTCGTACCAATGCATTCAGTGCTCCTCGTCAAGCATTCCGTCAACAATCC
CGTCGTGGATATGCTTCTCAAGGACCTGCCAAATCTTCCTTCCCTCTCTCCGTTGGGGTTGCTGCTTTGGCCATTGCTGGAGGTGCTGGATACTACTTTGTATCTCAAGGAAATGGATCA
CTCTTGAGTGGTTCTGCTAAAGAAACTGCCGGTCTCATCACTCCTAAGTTTGAAGATTATCAAAAGGTTTATAATGAGATTGCCGCGAGATTGGAGGAGAAAGATGATTATGATGATGGT
TCTTATGGACCTGTCTTAGTCAGATTAGCGTGGCATGCAAGTGGAACTTTCGATAAGGCAACTGGTACTGGTGGTAGCAATGGTGCGACTATGAGATTTGCCCCTGAGGGTGATCATGGT
GCCAATGCTGGTTTGGTTGCTGCCAGAGACTTCTTGCAACCTGTTAAGG
GTAAGTCAACCATCTTTTTTTCTATGGAAGAGGAAGTGTCGCTCCGCTGGCCCTTCGGGGACCACTGCCGT
GGAGGCAGACTATTGAAGAGGCTATTTTTAACAAATGAAACAAATTGAGGAGTCTCCTTACTAATATTTCTATAGCAAAGTTCCCATGGATCTCCTACTCTGACCTCTGGATCCTGGCTG
GTATTTGCGCTATCCAGGAAATGCAAGGTCCAACCATTCCTTTCCGACCAGGTAGACAAGATAAGGAAGCTGCAGCTTGCACACCTGATGGACGTCTCCCAGATGCTTCTCAAGGTAACA
AACATTTGAGAGATATCTTTGGTCGTATGGGATTCAATGATCAAGAAATCGTTGCTTTGAGTGGTGCTCATGCTCTTGGTCGTTGCCACACTGATCGTAGTGGTTTTGAGGGTCCTTGGA
CTTTCTCCCCAACTGTTGTCACCAATGAGTACTACAAGCTTTTGTTGAATGAGAAGTGGAACTGGAAGAAGTGGAATGGTCCTAAGCAG
GTATGAATATCTCCCCAATCTTTCCTTCCTG
GACTTTAAAGAAAACAAACTAACATATTAAACTAAAATAGTACGAAGACAAGACTACCAAAACCCTTATGATGCTTCCAACTGACATGGCTCTCGTCTCGGATAAAACTTTCCGTTCATA
CGTCGAGAAATACGCTGCAGATGAATCTCTCTTCATGAAAGATTTCGCAAATGTTATCACCAAGCTCTTTGAACTCGGTGTTCCTTTCGCAGAGACCACAGAACAAGGTCCTATGAAATT
CAAGCCTACTGCCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCTACTACTCGAACCTTCGCTAGGGCAGGCGCTGCATTCAAGTCAACACCTTTCAGATCCGCCACTCGTACCAATGCATTCAGTGCTCCTCGTCAAGCATTCCGTCAACAATCC
CGTCGTGGATATGCTTCTCAAGGACCTGCCAAATCTTCCTTCCCTCTCTCCGTTGGGGTTGCTGCTTTGGCCATTGCTGGAGGTGCTGGATACTACTTTGTATCTCAAGGAAATGGATCA
CTCTTGAGTGGTTCTGCTAAAGAAACTGCCGGTCTCATCACTCCTAAGTTTGAAGATTATCAAAAGGTTTATAATGAGATTGCCGCGAGATTGGAGGAGAAAGATGATTATGATGATGGT
TCTTATGGACCTGTCTTAGTCAGATTAGCGTGGCATGCAAGTGGAACTTTCGATAAGGCAACTGGTACTGGTGGTAGCAATGGTGCGACTATGAGATTTGCCCCTGAGGGTGATCATGGT
GCCAATGCTGGTTTGGTTGCTGCCAGAGACTTCTTGCAACCTGTTAAGG
CAAAGTTCCCATGGATCTCCTACTCTGACCTCTGGATCCTGGCTGGTATTTGCGCTATCCAGGAAATGCAA
GGTCCAACCATTCCTTTCCGACCAGGTAGACAAGATAAGGAAGCTGCAGCTTGCACACCTGATGGACGTCTCCCAGATGCTTCTCAAGGTAACAAACATTTGAGAGATATCTTTGGTCGT
ATGGGATTCAATGATCAAGAAATCGTTGCTTTGAGTGGTGCTCATGCTCTTGGTCGTTGCCACACTGATCGTAGTGGTTTTGAGGGTCCTTGGACTTTCTCCCCAACTGTTGTCACCAAT
GAGTACTACAAGCTTTTGTTGAATGAGAAGTGGAACTGGAAGAAGTGGAATGGTCCTAAGCAG
TACGAAGACAAGACTACCAAAACCCTTATGATGCTTCCAACTGACATGGCTCTCGTC
TCGGATAAAACTTTCCGTTCATACGTCGAGAAATACGCTGCAGATGAATCTCTCTTCATGAAAGATTTCGCAAATGTTATCACCAAGCTCTTTGAACTCGGTGTTCCTTTCGCAGAGACC
ACAGAACAAGGTCCTATGAAATTCAAGCCTACTGCCTAG

Retrieve as FASTA