Entry information : BfuCcP02
Entry ID 3252
Creation 2006-06-07 (Christophe Dunand)
Last sequence changes 2006-06-07 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-26 (Christophe Dunand)
Peroxidase information: BfuCcP02
Name BfuCcP02
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Leotiomycetes Sclerotiniaceae Botryotinia
Organism Botryotinia fuckeliana (Botrytis cinerea Sclerotinia fuckeliana)    [TaxId: 40559 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BfuCcP02
start..stop
S start..stop
SsclCcP02 700 0 1..370 1..371
MbicCcP02 628 0 1..372 1..374
AmacrCcP01 605 0 1..372 1..370
MvarCcP01 601 0 1..372 1..375
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 158830..159355 526 N° 2 159545..159918 374 N° 3 159988..160206 219  
join(158830..159355,159545..159918,159988..160206)


exon

Literature and cross-references BfuCcP02
Literature Birren,B., Ma,L. and Lander,E. CONSRTM The Genome Assembly Team, The Genome Sequence of Botryotinia fuckeliana B05.10
DNA ref. JGI genome:   Supercontig_1.45 (158830..160206)
EST ref. GenBank:   FQ935945.1   FQ934739.1 [3' end]   FQ910700.1 [Fragment]
Protein sequence: BfuCcP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   372
PWM (Da):   %s   40653.13 Transmb domain:   %s   i51-73o
PI (pH):   %s   8.55
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASATRTFARAGAAFKSTPFRSATRTALSAPRQAFRQQSRRGYASEGPAKSSFPLSIGVAALAIAGGAGYYFVSQGNGSLLSGSAKETSGLFTPKFDDYQKVYNEIAERLEEKDDYDDGSYGPVLVRLAWHCSGTFDKETGTGGSNGATMRFAPEGDHGANAGLVAARDFLAPIKAKHPWISYSDLWILAGICAIQEMQGPVIPFRPGRQDKDAAACTPDGRLPDASQGNKHLRDIFGRMGFNDQEIVALSGAHALGRCHTDRSGFEGPWTFSPTVVTNDYYKLLLNEKWSWKKWNGPKYEDKTSKSLMMLPTDMALVSDKSFRSYVEKYANDESLFMKDFANVITRLFELGVPFAETTEQAPMKFKPTTA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns) and ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCCGCTACTCGAACCTTTGCTCGCGCAGGCGCTGCATTCAAATCAACACCTTTCAGATCCGCCACTCGCACTGCATTGAGTGCTCCTCGTCAAGCATTCCGTCAACAATCCCGT
CGTGGATATGCATCTGAAGGACCTGCCAAATCTTCCTTCCCTCTCTCTATCGGTGTTGCTGCTTTGGCCATTGCTGGAGGTGCTGGATATTACTTTGTTTCTCAAGGTAATGGATCACTC
TTGAGTGGTTCTGCCAAGGAAACCTCTGGTCTCTTCACACCTAAATTCGACGATTACCAAAAGGTTTACAACGAAATTGCAGAGAGATTGGAAGAGAAGGATGATTATGATGATGGTTCT
TACGGACCCGTCTTGGTCAGATTGGCGTGGCATTGCAGCGGAACTTTTGACAAGGAAACTGGTACTGGTGGTAGCAACGGTGCTACTATGAGATTCGCCCCAGAGGGTGACCATGGTGCC
AATGCTGGCTTGGTTGCTGCTAGAGATTTCTTGGCTCCTATTAAGG
GTAAGTCACTTATTTTACTTTTTGTGGATGAAGATTGTGTTACTCCTTCGGAGCGGGGGAGATGGAGACCAGTT
TGAAGAAGTTAGAGAAGACTTTTCAAACTGTTTCTCTCGATTTTTGAGCTATGGGATTTCGGGGCTTGTTCCTATCACACTTGGAGAAAGTAACTTCTTACTAACCTCTTCACAGCTAAG
CACCCATGGATCTCCTACTCTGATCTCTGGATCTTGGCCGGTATCTGTGCTATTCAAGAAATGCAAGGCCCAGTCATTCCTTTCCGACCAGGTAGACAAGATAAGGACGCTGCTGCTTGC
ACACCTGATGGACGTCTTCCAGATGCATCCCAAGGTAACAAGCACTTGAGAGATATCTTCGGTCGTATGGGATTCAATGATCAAGAAATCGTTGCTTTGAGTGGTGCTCACGCTCTTGGA
CGTTGCCACACTGATCGTAGTGGTTTCGAGGGACCTTGGACTTTCTCTCCAACAGTTGTTACCAACGACTACTACAAGCTCTTGTTGAATGAGAAGTGGAGCTGGAAGAAGTGGAATGGT
CCTAAGCAG
GTATGATTAACCCGTCTCTTCCCTTTGGGGTGCAAAATTGGTATAAACTAACATGTAATTTCAAAATAGTACGAAGACAAGACCTCCAAGTCTCTCATGATGCTTCCCACC
GACATGGCCCTCGTCTCTGATAAATCTTTTCGCTCATACGTTGAGAAATACGCAAATGATGAATCTCTCTTCATGAAGGACTTCGCAAATGTCATCACCAGGCTCTTTGAGCTCGGTGTT
CCTTTTGCAGAGACTACTGAACAAGCTCCCATGAAATTCAAGCCTACTACTGCCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCCGCTACTCGAACCTTTGCTCGCGCAGGCGCTGCATTCAAATCAACACCTTTCAGATCCGCCACTCGCACTGCATTGAGTGCTCCTCGTCAAGCATTCCGTCAACAATCCCGT
CGTGGATATGCATCTGAAGGACCTGCCAAATCTTCCTTCCCTCTCTCTATCGGTGTTGCTGCTTTGGCCATTGCTGGAGGTGCTGGATATTACTTTGTTTCTCAAGGTAATGGATCACTC
TTGAGTGGTTCTGCCAAGGAAACCTCTGGTCTCTTCACACCTAAATTCGACGATTACCAAAAGGTTTACAACGAAATTGCAGAGAGATTGGAAGAGAAGGATGATTATGATGATGGTTCT
TACGGACCCGTCTTGGTCAGATTGGCGTGGCATTGCAGCGGAACTTTTGACAAGGAAACTGGTACTGGTGGTAGCAACGGTGCTACTATGAGATTCGCCCCAGAGGGTGACCATGGTGCC
AATGCTGGCTTGGTTGCTGCTAGAGATTTCTTGGCTCCTATTAAGG
CTAAGCACCCATGGATCTCCTACTCTGATCTCTGGATCTTGGCCGGTATCTGTGCTATTCAAGAAATGCAAGGC
CCAGTCATTCCTTTCCGACCAGGTAGACAAGATAAGGACGCTGCTGCTTGCACACCTGATGGACGTCTTCCAGATGCATCCCAAGGTAACAAGCACTTGAGAGATATCTTCGGTCGTATG
GGATTCAATGATCAAGAAATCGTTGCTTTGAGTGGTGCTCACGCTCTTGGACGTTGCCACACTGATCGTAGTGGTTTCGAGGGACCTTGGACTTTCTCTCCAACAGTTGTTACCAACGAC
TACTACAAGCTCTTGTTGAATGAGAAGTGGAGCTGGAAGAAGTGGAATGGTCCTAAGCAG
TACGAAGACAAGACCTCCAAGTCTCTCATGATGCTTCCCACCGACATGGCCCTCGTCTCT
GATAAATCTTTTCGCTCATACGTTGAGAAATACGCAAATGATGAATCTCTCTTCATGAAGGACTTCGCAAATGTCATCACCAGGCTCTTTGAGCTCGGTGTTCCTTTTGCAGAGACTACT
GAACAAGCTCCCATGAAATTCAAGCCTACTACTGCCTAG

Retrieve as FASTA