Entry information : PtPrx104 (POPTR_0010s18250 / PT10G15780 / Potri.010G175100)
Entry ID 3255
Creation 2006-06-12 (Claudia Cosio)
Last sequence changes 2006-06-12 (Claudia Cosio)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-07 (Qiang Li)
Peroxidase information: PtPrx104 (POPTR_0010s18250 / PT10G15780 / Potri.010G175100)
Name (synonym) PtPrx104 (POPTR_0010s18250 / PT10G15780 / Potri.010G175100)
Class Class III peroxidase    [Orthogroup: Prx084]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx104
start..stop
S start..stop
MePrx96 480 2e-172 1..324 2..321
PpePrx49 430 2e-152 7..323 21..335
MtPrx18 426 5e-151 31..323 42..333
MePrx118 420 3e-148 8..323 29..343
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16578886..16579110 225 N° 2 16577864..16578649 786  
complement(join(16577864..16578649,16578886..16579110))


exon

Literature and cross-references PtPrx104 (POPTR_0010s18250 / PT10G15780 / Potri.010G175100)
Literature The genome of black cottonwood, Populus trichocarpa (Torr. & Gray. Science 313 (5793), 1596-1604 (2006).
DNA ref. Phytozome 12:   scaffold_10 (16579110..16577864)
Omic ref. ePlant:   Potri.010G175100
Protein sequence: PtPrx104 (POPTR_0010s18250 / PT10G15780 / Potri.010G175100)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336
PWM (Da):   %s   37460.25  
PI (pH):   %s   8.85
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVSAILPQNPVKDLVKPLGAPSILSPQDFLSLSYYQKTCPAAEEIIHRKMKAWFLKDYTLAASIIRLHFHDCAIRGCDASILLNHRNSERRAYASKTLRGFQVIDEIKAELERKCPKTVSCADILTAAARDATLLLGGPFWEVPFGRKDGKTSIAKEADLVPQGRENVTALIDFFQERGLSILDLVVLSGSHTIGRSSCYSFMHRLANYKGTGRPDPTLDRQYLRNLTGSCKWSSNLVNLDRTTPKTFDVEYYNNLGKKKGLLSTDQELYSDPRTAPFVSAFTDQQPDLFFNQFAASMVNLGNILVYTAPNESEIRLDCNYVNPAPSKKGNPPRRG*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGTCAGCCATATTGCCACAGAACCCTGTCAAAGATTTAGTTAAGCCTCTGGGAGCACCGTCGATCTTGTCTCCTCAAGATTTCCTGTCTCTTAGCTACTATCAAAAAACTTGTCCT
GCTGCTGAAGAAATAATTCACCGAAAAATGAAAGCTTGGTTTCTAAAGGATTACACCTTGGCAGCTAGCATCATTCGCTTGCACTTCCATGATTGCGCTATTAGG
GTAAGCACTAAATGA
TGACCAAAAATCTTGCACCTCTAATATATATCCTTCACGACCATTGCACTAGCTAGTATTCTCAACCTGAGAAAAGGTCTCAGGTTTTGGCATCTTTTATGCACCAAATGATGGTCATTA
ATTGGTTTTTTCCTTTTCTTTTAACTGATTTTATTAATGATAGAATTGCTAGTCTCGTATAAGTCTTATGAGACAAAAAATATTGACAACATGCAATGCAGGGATGTGATGCTTCTATCT
TGTTGAACCATCGAAATAGTGAAAGGAGAGCTTATGCTAGCAAGACACTGAGAGGTTTCCAAGTGATTGATGAAATTAAAGCAGAGCTTGAGAGGAAGTGTCCAAAAACTGTCTCATGCG
CGGACATTCTCACAGCTGCGGCTAGAGATGCCACTCTTCTGCTTGGAGGTCCATTCTGGGAAGTCCCATTTGGGCGTAAAGATGGAAAAACTTCCATTGCCAAAGAGGCTGACCTTGTTC
CTCAGGGCCGCGAAAATGTCACAGCTCTGATTGATTTCTTCCAGGAAAGAGGATTGAGCATTCTTGATTTGGTTGTTCTCTCAGGTTCACACACAATTGGAAGGAGCAGTTGCTATTCAT
TCATGCACAGACTCGCTAACTATAAGGGAACTGGCAGGCCTGATCCTACCCTTGACAGACAATACTTGAGGAACTTGACAGGAAGTTGCAAATGGAGTTCTAACTTGGTCAATCTAGATA
GAACAACTCCAAAGACTTTTGACGTGGAGTACTACAACAACCTTGGCAAGAAAAAGGGGTTGTTGTCAACAGATCAAGAACTCTACTCGGATCCAAGAACTGCGCCATTCGTTTCAGCAT
TCACAGATCAGCAGCCTGACCTTTTCTTTAATCAGTTTGCAGCGTCAATGGTGAATCTTGGAAACATTCTTGTCTATACTGCTCCGAATGAAAGCGAAATCAGACTGGACTGTAATTATG
TTAATCCCGCACCTAGCAAAAAGGGCAATCCACCACGACGCGGTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGTCAGCCATATTGCCACAGAACCCTGTCAAAGATTTAGTTAAGCCTCTGGGAGCACCGTCGATCTTGTCTCCTCAAGATTTCCTGTCTCTTAGCTACTATCAAAAAACTTGTCCT
GCTGCTGAAGAAATAATTCACCGAAAAATGAAAGCTTGGTTTCTAAAGGATTACACCTTGGCAGCTAGCATCATTCGCTTGCACTTCCATGATTGCGCTATTAGG
GGATGTGATGCTTCT
ATCTTGTTGAACCATCGAAATAGTGAAAGGAGAGCTTATGCTAGCAAGACACTGAGAGGTTTCCAAGTGATTGATGAAATTAAAGCAGAGCTTGAGAGGAAGTGTCCAAAAACTGTCTCA
TGCGCGGACATTCTCACAGCTGCGGCTAGAGATGCCACTCTTCTGCTTGGAGGTCCATTCTGGGAAGTCCCATTTGGGCGTAAAGATGGAAAAACTTCCATTGCCAAAGAGGCTGACCTT
GTTCCTCAGGGCCGCGAAAATGTCACAGCTCTGATTGATTTCTTCCAGGAAAGAGGATTGAGCATTCTTGATTTGGTTGTTCTCTCAGGTTCACACACAATTGGAAGGAGCAGTTGCTAT
TCATTCATGCACAGACTCGCTAACTATAAGGGAACTGGCAGGCCTGATCCTACCCTTGACAGACAATACTTGAGGAACTTGACAGGAAGTTGCAAATGGAGTTCTAACTTGGTCAATCTA
GATAGAACAACTCCAAAGACTTTTGACGTGGAGTACTACAACAACCTTGGCAAGAAAAAGGGGTTGTTGTCAACAGATCAAGAACTCTACTCGGATCCAAGAACTGCGCCATTCGTTTCA
GCATTCACAGATCAGCAGCCTGACCTTTTCTTTAATCAGTTTGCAGCGTCAATGGTGAATCTTGGAAACATTCTTGTCTATACTGCTCCGAATGAAAGCGAAATCAGACTGGACTGTAAT
TATGTTAATCCCGCACCTAGCAAAAAGGGCAATCCACCACGACGCGGTTAA

Retrieve as FASTA