Entry information : AsPrx06 (Prxc6)
Entry ID 327
Creation 2006-01-18 (Christophe Dunand)
Last sequence changes 2015-12-07 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-12-09 (Achraf Jemmat)
Peroxidase information: AsPrx06 (Prxc6)
Name (synonym) AsPrx06 (Prxc6)
Class Class III peroxidase    [Orthogroup: Prx048]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Avena
Organism Avena sativa (Oat)    [TaxId: 4498 ]
Cellular localisation N/D
Tissue types Seedlings
Stems
Inducers Erysiphe graminis infection
Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value AsPrx06
start..stop
S start..stop
AsPrx02 589 0 1..316 1..315
TaPrx112-1B 483 3e-174 1..316 3..314
AvePrx112-1A 483 4e-174 1..316 3..314
AvePrx112-1C 480 6e-173 1..316 3..314
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4..213 210 N° 2 339..515 177 N° 3 631..1194 564  
join(4..213,339..515,631..1194)


exon

Literature and cross-references AsPrx06 (Prxc6)
Literature Cheng,D.W. and Armstrong,K.C. Molecular cloning and characterization of peroxidase genes from oat(Avena sativa L. var. Ogle) which may be involved in induced resistance to Erysiphe graminis f. sp. tritici
Protein ref. UniProtKB:   O81525
DNA ref. GenBank:   AF078872.1
Protein sequence: AsPrx06 (Prxc6)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316 (293)
PWM (Da):   %s   32444.1 (30269.0)  
PI (pH):   %s   8.33 (8.21) Peptide Signal:   %s   cut: 24 range:24-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSASCISLRVMLVALAATAASAQLSSTFYDTSCPKALATIKSGVAAAVSSDRRMGASLLRLHFHDCFVNGCDASVLLSGNEQNAAPNAGSLRGFSVIDNIKTQVEAVCKQTVSCADILAVAARDSVVALGGPFLEQVPLGRRDSTSATGNTGDLPAPTSSLAQLQAAFSKKNLDTTGMVALSGAHTIGQAQCKNFRSRIYGGDTNINAAFATSLQANCPQATGGSGDSSLAPLDTKTPNAFDNSYYNNLLSQKGLLHSDQVLFNNGTTDNTVRNFASSASAFTGAFTTAMIKMGNISPLTGTQGQIRLSCSKVNS*

Retrieve as FASTA  
Remarks Complete sequence from Genomic (introns 1 and 2). Incorrect splicing prediction from NCBI. Cultivar="Ogle"
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTCTGCCTCTTGCATTTCTTTGCGTGTGATGCTGGTCGCTCTGGCTGCTACGGCGGCGTCGGCGCAGCTGTCTTCGACGTTCTACGACACGTCGTGCCCCAAGGCCCTGGCCACC
ATCAAGAGCGGCGTGGCGGCCGCCGTGAGCAGCGACCGGCGCATGGGCGCGTCGCTGCTCCGGCTGCACTTCCACGACTGCTTTGTTAAT
GTGAGCAAGTTTCGGCGTTTCACCATTACC
GGCAGTAATTTTTCGTTCATTAACTAACTTGCTAGGGTAAAAACAGTTAGCCGTGATTAACAAGTGTTGCGCCGTGCATGTTTTGGTGTCTGCAGGGCTGTGACGCGTCCGTTCTGCTGT
CGGGCAACGAGCAGAACGCGGCACCGAACGCGGGGTCGCTGAGGGGCTTCAGCGTCATCGACAACATCAAGACCCAGGTGGAGGCCGTGTGCAAGCAGACTGTGTCATGTGCCGACATCC
TCGCCGTCGCCGCCCGTGACTCCGTCGTCGCG
GTAAGCAGCATCATCATCTACGAGACTACGACTAGTTACATACAAAAGAATTATTCTACCGGAAGCTAGCTATATAGTCCTATCGATT
TTTACTTTGGAATGGGTCATGCGCCAGCTTGGAGGGCCATTCCTGGAACAAGTTCCTCTAGGGAGACGGGACTCCACGAGCGCAACCGGGAACACCGGCGACCTCCCGGCCCCTACTTCC
AGCCTAGCACAGCTCCAGGCCGCGTTCAGCAAGAAGAACCTGGACACGACAGGCATGGTGGCGCTCTCGGGCGCGCACACCATCGGGCAGGCGCAGTGCAAGAACTTCCGGTCGAGGATT
TACGGCGGCGACACCAACATCAACGCCGCCTTCGCGACGTCGCTCCAGGCCAACTGCCCCCAGGCGACCGGCGGCTCCGGCGACAGCAGCCTGGCGCCGCTGGACACGAAGACCCCCAAC
GCGTTCGACAACAGCTACTACAACAATCTCCTGTCCCAGAAGGGACTTCTGCACTCTGACCAGGTGCTGTTCAACAACGGCACCACCGACAACACCGTCAGGAACTTCGCGTCCAGCGCG
TCGGCGTTCACCGGCGCCTTCACCACCGCCATGATCAAGATGGGAAACATCTCGCCGCTGACCGGGACGCAGGGCCAGATCAGGCTCAGCTGCTCCAAGGTGAACTCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTCTGCCTCTTGCATTTCTTTGCGTGTGATGCTGGTCGCTCTGGCTGCTACGGCGGCGTCGGCGCAGCTGTCTTCGACGTTCTACGACACGTCGTGCCCCAAGGCCCTGGCCACC
ATCAAGAGCGGCGTGGCGGCCGCCGTGAGCAGCGACCGGCGCATGGGCGCGTCGCTGCTCCGGCTGCACTTCCACGACTGCTTTGTTAAT
GGCTGTGACGCGTCCGTTCTGCTGTCGGGC
AACGAGCAGAACGCGGCACCGAACGCGGGGTCGCTGAGGGGCTTCAGCGTCATCGACAACATCAAGACCCAGGTGGAGGCCGTGTGCAAGCAGACTGTGTCATGTGCCGACATCCTCGCC
GTCGCCGCCCGTGACTCCGTCGTCGCG
CTTGGAGGGCCATTCCTGGAACAAGTTCCTCTAGGGAGACGGGACTCCACGAGCGCAACCGGGAACACCGGCGACCTCCCGGCCCCTACTTCC
AGCCTAGCACAGCTCCAGGCCGCGTTCAGCAAGAAGAACCTGGACACGACAGGCATGGTGGCGCTCTCGGGCGCGCACACCATCGGGCAGGCGCAGTGCAAGAACTTCCGGTCGAGGATT
TACGGCGGCGACACCAACATCAACGCCGCCTTCGCGACGTCGCTCCAGGCCAACTGCCCCCAGGCGACCGGCGGCTCCGGCGACAGCAGCCTGGCGCCGCTGGACACGAAGACCCCCAAC
GCGTTCGACAACAGCTACTACAACAATCTCCTGTCCCAGAAGGGACTTCTGCACTCTGACCAGGTGCTGTTCAACAACGGCACCACCGACAACACCGTCAGGAACTTCGCGTCCAGCGCG
TCGGCGTTCACCGGCGCCTTCACCACCGCCATGATCAAGATGGGAAACATCTCGCCGCTGACCGGGACGCAGGGCCAGATCAGGCTCAGCTGCTCCAAGGTGAACTCGTGA

Retrieve as FASTA