Entry information : AsPrx02 (Prxc2)
Entry ID 328
Creation 2006-01-18 (Christophe Dunand)
Last sequence changes 2015-12-07 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-12-09 (Achraf Jemmat)
Peroxidase information: AsPrx02 (Prxc2)
Name (synonym) AsPrx02 (Prxc2)
Class Class III peroxidase    [Orthogroup: Prx047]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Avena
Organism Avena sativa (Oat)    [TaxId: 4498 ]
Cellular localisation N/D
Tissue types Seedlings
Stems
Inducers Erysiphe graminis infection
Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value AsPrx02
start..stop
S start..stop
AsPrx06 589 0 1..315 1..316
TaPrx112-1B 498 5e-180 1..315 3..314
AvePrx112-1A 498 9e-180 1..315 3..314
AvePrx112-1C 494 1e-178 1..315 3..314
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4..213 210 N° 2 339..515 177 N° 3 628..1188 561  
join(4..213,339..515,628..1188)


exon

Literature and cross-references AsPrx02 (Prxc2)
Literature Cheng,D.W. and Armstrong,K.C. Molecular cloning and characterization of peroxidase genes from oat(Avena sativa L. var. Ogle) which may be involved in induced resistance to Erysiphe graminis f. sp. tritici
Protein ref. UniProtKB:   O81524
DNA ref. GenBank:   AF078871.1
Protein sequence: AsPrx02 (Prxc2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   315 (292)
PWM (Da):   %s   32403 (30227.9)  
PI (pH):   %s   8.15 (7.99) Peptide Signal:   %s   cut: 24 range:24-315
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSASCISLRVMLVALAATAASAQLSSTFYDTSCPKALATIKSGVAAAVSSDRRMGASLLRLHFHDCFVNGCDASVLLSGNEQNAAPNAGSLRGFSVIDNIKTQVEAVCKQTVSCDDILAVAARDSVVALGGPSWTVPLGRRDSTSATGNTGDLPAPTSSLAQLQAAFSKKNLDTTDMVALSGAHTIGQAQCKNFRSRIYGGDTNINAAFATSLQANCPQATGGSGDSSLAPLDTKTPNAFDNSYYNNLLSQKGLLHSDQVLFNNGTTDNTVRNFASSASAFTGAFTTAMIKMGNISPLTGTQGQIRLSCSKVNS*

Retrieve as FASTA  
Remarks Complete sequence from Genomic (introns 1 and 2). Incorrect splicing prediction from NCBI. Cultivar="Ogle"
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTCTGCCTCTTGCATTTCTTTGCGTGTGATGCTGGTCGCTCTGGCTGCTACGGCGGCGTCGGCGCAGCTGTCTTCGACGTTCTACGACACGTCGTGCCCCAAGGCCCTGGCCACC
ATCAAGAGCGGCGTGGCGGCCGCCGTGAGCAGCGACCGGCGCATGGGCGCGTCGCTGCTCCGGCTGCACTTCCACGACTGCTTTGTTAAT
GTGAGCAAGTTTCGGCGTTTCACCATTACC
GGCAGTAATTTTTCGTTCATTAACTAACTTGCTAGGGTAAAAACAGTTAGCCGTGATTAACAAGTGTTGCGCCGTGCATGTTTTGGTGTCTGCAGGGCTGTGACGCGTCCGTTCTGCTGT
CGGGCAACGAGCAGAACGCGGCACCGAACGCGGGGTCGCTGAGGGGCTTCAGTGTCATCGACAACATCAAGACCCAGGTGGAGGCCGTGTGCAAGCAGACTGTGTCATGTGACGACATCC
TCGCCGTCGCCGCCCGTGACTCCGTCGTCGCG
GTAAGCAGCATCATCATCTACGAGACTACGACTAGTTACATACAAAAGAATTATTCTACCGGAAGCTAGCTATATAGTCCTATCGATT
TTTACTTGGAATGGTCATGCGCAGCTTGGAGGGCCGTCCTGGACAGTTCCTCTAGGGAGACGGGACTCCACGAGCGCAACCGGGAACACCGGCGACCTCCCGGCCCCTACTTCCAGCCTA
GCACAGCTCCAGGCCGCGTTCAGCAAGAAGAACCTGGACACGACAGACATGGTGGCGCTCTCGGGCGCGCACACCATCGGGCAGGCGCAGTGCAAGAACTTCCGGTCGAGGATTTACGGC
GGCGACACCAACATCAACGCCGCCTTCGCGACGTCGCTCCAGGCCAACTGCCCCCAGGCGACCGGCGGCTCCGGCGACAGCAGCCTGGCGCCGCTGGACACGAAGACCCCCAACGCGTTC
GACAACAGCTACTACAACAATCTCCTGTCCCAGAAGGGACTTCTGCACTCTGACCAGGTGCTGTTCAACAACGGCACCACCGACAACACCGTCAGGAACTTCGCGTCCAGCGCGTCGGCG
TTCACCGGCGCCTTCACCACCGCCATGATCAAGATGGGAAACATCTCGCCGCTGACCGGGACGCAGGGCCAGATCAGGCTCAGCTGCTCCAAGGTGAACTCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTCTGCCTCTTGCATTTCTTTGCGTGTGATGCTGGTCGCTCTGGCTGCTACGGCGGCGTCGGCGCAGCTGTCTTCGACGTTCTACGACACGTCGTGCCCCAAGGCCCTGGCCACC
ATCAAGAGCGGCGTGGCGGCCGCCGTGAGCAGCGACCGGCGCATGGGCGCGTCGCTGCTCCGGCTGCACTTCCACGACTGCTTTGTTAAT
GGCTGTGACGCGTCCGTTCTGCTGTCGGGC
AACGAGCAGAACGCGGCACCGAACGCGGGGTCGCTGAGGGGCTTCAGTGTCATCGACAACATCAAGACCCAGGTGGAGGCCGTGTGCAAGCAGACTGTGTCATGTGACGACATCCTCGCC
GTCGCCGCCCGTGACTCCGTCGTCGCG
CTTGGAGGGCCGTCCTGGACAGTTCCTCTAGGGAGACGGGACTCCACGAGCGCAACCGGGAACACCGGCGACCTCCCGGCCCCTACTTCCAGC
CTAGCACAGCTCCAGGCCGCGTTCAGCAAGAAGAACCTGGACACGACAGACATGGTGGCGCTCTCGGGCGCGCACACCATCGGGCAGGCGCAGTGCAAGAACTTCCGGTCGAGGATTTAC
GGCGGCGACACCAACATCAACGCCGCCTTCGCGACGTCGCTCCAGGCCAACTGCCCCCAGGCGACCGGCGGCTCCGGCGACAGCAGCCTGGCGCCGCTGGACACGAAGACCCCCAACGCG
TTCGACAACAGCTACTACAACAATCTCCTGTCCCAGAAGGGACTTCTGCACTCTGACCAGGTGCTGTTCAACAACGGCACCACCGACAACACCGTCAGGAACTTCGCGTCCAGCGCGTCG
GCGTTCACCGGCGCCTTCACCACCGCCATGATCAAGATGGGAAACATCTCGCCGCTGACCGGGACGCAGGGCCAGATCAGGCTCAGCTGCTCCAAGGTGAACTCGTGA

Retrieve as FASTA