Entry information : GzPGHS01
Entry ID 3319
Creation 2007-01-31 (Christophe Dunand)
Last sequence changes 2007-01-31 (Christophe Dunand)
Sequence status complete
Reviewer Marcel Zamocky
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: GzPGHS01
Name GzPGHS01
Class H synthase    [Orthogroup: PGHS001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Nectriaceae Gibberella
Organism Gibberella zeae (anamorph Fusarium graminearum)    [TaxId: 5518 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GzPGHS01
start..stop
S start..stop
FoPGHS 1174 0 22..660 2..641
GmoPGHS01 1154 0 1..660 1..665
NhaePGHS 1053 0 9..657 16..673
RrufPGHS 805 0 25..656 11..623
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2731819..2732913 1095 N° 2 2732964..2733776 813 N° 3 2733827..2733901 75  
join(2731819..2732913,2732964..2733776,2733827..2733901)


exon

Literature and cross-references GzPGHS01
Literature Zamocky M. et al. (2007) Phylogenetic relationship in the peroxidase-cyclooxygenase superfamily (in preparation).
DNA ref. JGI genome:   Supercontig_3.5 (2731819..2733901)
mRNA ref. GenBank:   XM_388327.1
Protein sequence: GzPGHS01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   660
PWM (Da):   %s   74239.7 Transmb domain:   %s   i7-25o
PI (pH):   %s   6.77
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASVTSIIFVALVAGVLYAARMSLVPILKSLYIRLWKGVNHFIEWHKLPTWFAVFNLLALRYELREGNLHDTSPNAEFQGTDKCPMSDSKFVSSRDSDGLYNDLKQPKMGCAGMRFGRNVPRKYTKPPTEQELLTPNPRVISEKILARPEGQFKPAEIVNLLAAAWIQFQVHDWAQHFLVTNGDKDIDIPLHNKDKWTEQSMKIPRTKKADILSKQDAETPAYDNENTHWWDASQIYGSSEAETQALRAKCHKSKPGQLEVSVADGEQFLPRSADGIPKTGFRQNWWLGLELLHTLFALEHNAIATQLHLSNPSWSSDHIFDTARLINCALMAKIHTVEWTPGILQHPALQIGMNANWWGLLGDKLWHAFGRVFDNKSEVISGIPGSGVDHDKAPYCLTEEFVSVYRLHSLIPDNVAFFNIKDGQHEGTLPIVDVSFESARKPFDEGKSGLGLSFADVFYSFGVNYPGAIRAHNMPNFLRDLKIPADKDFPEGRHLDLGTIDILRDRERGVPRYNAFRRLFHMPAAKSFIDLTGGDDKLASELEEVYEGDLEAVDLLVGTLCEPLPKGFGFSDTAFRVFILMATRRIKSDRFIAGDGWCPEVYTREGMDWVQKNTMKDVLCRHFPELAAPLHNVKNAFAPWTKLGQTAAYAGPETNKAKS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). No EST. Strain="PH-1 / NRRL 31084".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTGTCACTTCAATTATCTTTGTCGCACTCGTTGCAGGAGTCTTATATGCCGCCAGAATGTCCCTCGTCCCTATTCTCAAATCTCTATACATCCGTCTTTGGAAAGGTGTTAAC
CATTTCATTGAATGGCACAAACTTCCTACCTGGTTCGCTGTCTTTAATCTCCTTGCCCTTCGATATGAACTTCGCGAGGGGAACTTGCACGATACATCCCCCAATGCAGAATTCCAGGGT
ACCGACAAATGTCCGATGAGTGACTCCAAGTTCGTTTCTTCAAGAGACTCAGATGGTCTCTACAATGATCTCAAGCAACCCAAGATGGGATGTGCTGGAATGAGGTTCGGTCGCAATGTT
CCGAGGAAGTACACAAAGCCGCCAACTGAACAGGAATTGCTCACACCCAACCCAAGAGTTATCTCGGAAAAGATCCTTGCCAGGCCTGAAGGCCAATTCAAACCAGCTGAGATCGTCAAT
CTTCTCGCCGCGGCATGGATCCAGTTCCAGGTCCATGACTGGGCGCAGCACTTCCTAGTTACAAACGGCGACAAGGATATCGACATCCCACTCCACAATAAAGACAAGTGGACTGAACAA
TCAATGAAGATCCCCCGTACCAAGAAAGCCGATATCTTGTCGAAGCAGGATGCAGAGACACCTGCTTACGACAACGAAAACACACATTGGTGGGACGCTTCTCAGATCTACGGATCAAGC
GAAGCCGAAACACAAGCCCTTCGCGCTAAATGCCACAAGTCAAAGCCTGGTCAACTAGAAGTAAGTGTCGCTGACGGCGAACAATTTCTTCCCCGATCAGCAGATGGTATTCCCAAGACT
GGTTTCAGACAGAATTGGTGGCTTGGTCTTGAACTTTTGCACACTCTGTTTGCTCTTGAGCACAATGCCATCGCTACACAGCTTCATCTTTCGAATCCTAGTTGGTCGAGTGATCATATT
TTTGATACAGCCAGGTTGATCAATTGTGCTCTTATGGCCAAGATTCATACTGTTGAGTGGACGCCTGGTATTTTGCAGCATCCTGCGCTGCAGATTGGAATGAACGCGAATTGGTGGGGC
TTGCTCGGTGATAAG
GTAGGTTTGTTAGTCTTTGAACAAGGGTCAACTACTAACCACACAAACAGCTTTGGCACGCTTTTGGTCGCGTGTTTGACAACAAGTCTGAAGTCATCTCTGGTA
TCCCAGGTTCAGGCGTAGACCACGACAAAGCACCCTACTGCCTCACAGAAGAATTCGTCTCGGTCTACCGCCTTCATTCTCTCATCCCTGACAATGTCGCCTTCTTCAACATTAAAGACG
GCCAGCATGAAGGGACCCTTCCCATCGTGGACGTTTCGTTTGAGTCTGCTCGTAAACCCTTCGACGAAGGAAAGTCTGGTCTAGGACTTTCCTTTGCCGACGTCTTCTACTCATTCGGTG
TCAATTATCCCGGTGCTATTCGGGCTCATAACATGCCCAACTTCTTACGCGATTTGAAGATCCCTGCCGATAAAGACTTTCCTGAGGGGAGACACTTGGATTTGGGAACTATCGATATTC
TTCGAGATCGTGAGCGAGGTGTTCCTCGTTACAATGCTTTCCGTCGTCTATTCCACATGCCTGCTGCTAAGAGCTTTATCGACCTCACTGGCGGCGACGACAAACTGGCATCTGAGTTGG
AGGAGGTGTATGAAGGTGATCTCGAAGCCGTTGACCTTCTAGTCGGTACACTCTGTGAGCCTCTCCCCAAGGGTTTCGGTTTCAGTGACACAGCCTTCCGCGTCTTCATCCTCATGGCCA
CTCGTCGCATCAAGTCGGATCGATTCATCGCTGGCGATGGTTGGTGTCCTGAAGTTTACACGCGCGAGGGTATGGATTGGGTGCAGAAGAACACCATGAAGGATGTTCTGTGCAGACACT
TCCCTGAACTTGCTGCGCCATTGCATAATGTTAAGAAT
GTGAGTACCGTTTTGACTCGAATACAGGGACTGGAAACTAACTGTGATAGGCTTTCGCGCCATGGACGAAGCTTGGCCAGAC
AGCGGCTTATGCAGGACCTGAGACGAACAAGGCAAAGTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTGTCACTTCAATTATCTTTGTCGCACTCGTTGCAGGAGTCTTATATGCCGCCAGAATGTCCCTCGTCCCTATTCTCAAATCTCTATACATCCGTCTTTGGAAAGGTGTTAAC
CATTTCATTGAATGGCACAAACTTCCTACCTGGTTCGCTGTCTTTAATCTCCTTGCCCTTCGATATGAACTTCGCGAGGGGAACTTGCACGATACATCCCCCAATGCAGAATTCCAGGGT
ACCGACAAATGTCCGATGAGTGACTCCAAGTTCGTTTCTTCAAGAGACTCAGATGGTCTCTACAATGATCTCAAGCAACCCAAGATGGGATGTGCTGGAATGAGGTTCGGTCGCAATGTT
CCGAGGAAGTACACAAAGCCGCCAACTGAACAGGAATTGCTCACACCCAACCCAAGAGTTATCTCGGAAAAGATCCTTGCCAGGCCTGAAGGCCAATTCAAACCAGCTGAGATCGTCAAT
CTTCTCGCCGCGGCATGGATCCAGTTCCAGGTCCATGACTGGGCGCAGCACTTCCTAGTTACAAACGGCGACAAGGATATCGACATCCCACTCCACAATAAAGACAAGTGGACTGAACAA
TCAATGAAGATCCCCCGTACCAAGAAAGCCGATATCTTGTCGAAGCAGGATGCAGAGACACCTGCTTACGACAACGAAAACACACATTGGTGGGACGCTTCTCAGATCTACGGATCAAGC
GAAGCCGAAACACAAGCCCTTCGCGCTAAATGCCACAAGTCAAAGCCTGGTCAACTAGAAGTAAGTGTCGCTGACGGCGAACAATTTCTTCCCCGATCAGCAGATGGTATTCCCAAGACT
GGTTTCAGACAGAATTGGTGGCTTGGTCTTGAACTTTTGCACACTCTGTTTGCTCTTGAGCACAATGCCATCGCTACACAGCTTCATCTTTCGAATCCTAGTTGGTCGAGTGATCATATT
TTTGATACAGCCAGGTTGATCAATTGTGCTCTTATGGCCAAGATTCATACTGTTGAGTGGACGCCTGGTATTTTGCAGCATCCTGCGCTGCAGATTGGAATGAACGCGAATTGGTGGGGC
TTGCTCGGTGATAAG
CTTTGGCACGCTTTTGGTCGCGTGTTTGACAACAAGTCTGAAGTCATCTCTGGTATCCCAGGTTCAGGCGTAGACCACGACAAAGCACCCTACTGCCTCACAGAA
GAATTCGTCTCGGTCTACCGCCTTCATTCTCTCATCCCTGACAATGTCGCCTTCTTCAACATTAAAGACGGCCAGCATGAAGGGACCCTTCCCATCGTGGACGTTTCGTTTGAGTCTGCT
CGTAAACCCTTCGACGAAGGAAAGTCTGGTCTAGGACTTTCCTTTGCCGACGTCTTCTACTCATTCGGTGTCAATTATCCCGGTGCTATTCGGGCTCATAACATGCCCAACTTCTTACGC
GATTTGAAGATCCCTGCCGATAAAGACTTTCCTGAGGGGAGACACTTGGATTTGGGAACTATCGATATTCTTCGAGATCGTGAGCGAGGTGTTCCTCGTTACAATGCTTTCCGTCGTCTA
TTCCACATGCCTGCTGCTAAGAGCTTTATCGACCTCACTGGCGGCGACGACAAACTGGCATCTGAGTTGGAGGAGGTGTATGAAGGTGATCTCGAAGCCGTTGACCTTCTAGTCGGTACA
CTCTGTGAGCCTCTCCCCAAGGGTTTCGGTTTCAGTGACACAGCCTTCCGCGTCTTCATCCTCATGGCCACTCGTCGCATCAAGTCGGATCGATTCATCGCTGGCGATGGTTGGTGTCCT
GAAGTTTACACGCGCGAGGGTATGGATTGGGTGCAGAAGAACACCATGAAGGATGTTCTGTGCAGACACTTCCCTGAACTTGCTGCGCCATTGCATAATGTTAAGAAT
GCTTTCGCGCCA
TGGACGAAGCTTGGCCAGACAGCGGCTTATGCAGGACCTGAGACGAACAAGGCAAAGTCTTGA

Retrieve as FASTA