Entry information : PpaPrx12
Entry ID 3327
Creation 2006-07-28 (Christophe Dunand)
Last sequence changes 2006-07-28 (Christophe Dunand)
Sequence status complete
Reviewer Filippo Passardi
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: PpaPrx12
Name PpaPrx12
Class Class III peroxidase    [Orthogroup: Prx178]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx12
start..stop
S start..stop
PpaPrx21 522 0 1..318 1..317
PpaPrx20 508 0 29..320 23..314
PpaPrx30 469 2e-168 20..320 19..319
PpaPrx34 288 8e-97 27..319 20..314
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1685422..1685652 231 N° 2 1684471..1684819 349 N° 3 1683970..1684352 383  
complement(join(1683970..1684352,1684471..1684819,1685422..1685652))


exon

Literature and cross-references PpaPrx12
Literature Kuroki,Y., Toyoda,A., Sakaki,Y., Tanahashi,T., Nishiyama,T.,Hiwatashi,Y., Suzuki,Y., Sugano,S., Fujiyama,A. and Hasebe,M. Evolution of developmental genes in land plants. Unpublished (2006)
DNA ref. Phytozome 12:   scaffold_10 (1685652..1683970)
EST ref. GenBank:   BJ975480 [5' end]   BY991577 [5' end]
Cluster/Prediction ref. UniGene:   Ppa.10642
Protein sequence: PpaPrx12
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320
PWM (Da):   %s   33668.36 Transmb domain:   %s   i7-26o
PI (pH):   %s   4.53
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAGWTAALLGAAAAGVYMVLFLGTTVHAELQYGYYDSLGCAGVEDRVRTLVQRSFVADATASAAMLRLAFHDCQVGPGGCDASIMIDEDAGEMASGNNFGIKRLDIINSVKADMEDNCPNTVSCADIIAMAGRDAVAFNGGPDIQIPLGRKDADSSNAGEADSKLPPATSSIDRVFNVFGPFGMTPEEIVAILGAHSIGVGHCKNIQDRLQSNSPTAPNSLVFRTQLMAACAVNVFDIAVVNNDATQFTFDNQYFQDIQNGRGLFTVDHLLSTDPRTAPIVNTYASNEGAFFASFASAYVKLTSRAVTGNRGSVRSTCQL

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 3) and 24 ESTs. Ecotype="Gransden 2004".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGGCTGGACTGCAGCACTGCTTGGGGCGGCGGCAGCTGGAGTATATATGGTTCTGTTTCTAGGGACAACAGTTCATGCGGAGCTGCAATACGGGTATTATGATAGCTTGGGATGC
GCCGGGGTGGAAGATAGAGTGCGAACTTTAGTGCAGCGCAGCTTTGTCGCTGATGCTACAGCTAGTGCTGCCATGTTGCGCCTTGCCTTCCACGACTGCCAAGTTGGACCG
GTAAGTCCA
CATTCACAATCTTAGCACAATGGATAATGGCGGTGCAGTGGGGAGGACATTTCTGCAAAAACATAGTTCAAGCATGGTCTTCATCATTGCGCTTCAGCGATCTTCGGTGATACGCAGGCG
TAGCAGATGAACTGGTTGCGAGAGAGTAAATCCCCGTCGGCATATATCTCTGAGGATGTGAGAATATGCATAGAAATATTCATGAATGATGACCTCTCGAAACGCTGTTGTCAACAATCC
GTGGAAAGTTGGTTGTCGATTGCCATTGAAATGCGTGGCACCGCATAAGTCTGGAATTACATTCACGATTGGGGGAAATGGCCGATTCCAAAATAGATTGAATACTCGTCGTAAATTGAT
CACGTCTGGGCTGCGAAAAGATTTGAATGCCGCATCTAAGTAACAATTTGAAGTAATTTTACATGACATACTCGCAATCAAGAGGACAACTACTGCGTGGAATTAAAAGGGTACCGCTAA
TCAAGTGATCTCAGCTGAGATGCAGAGCTACATCTTATTACGTTGCATTCCGTATTCGCTGTGGTGTCCATGAATTTATTCACTTTGCTGAATTGGATTTCTCATTTCTGCAGGGAGGAT
GCGATGCCTCCATCATGATCGATGAGGATGCGGGAGAGATGGCCTCCGGAAACAATTTTGGCATTAAGCGCCTCGATATCATCAACTCAGTGAAAGCCGACATGGAGGACAATTGCCCAA
ATACAGTTTCTTGCGCAGACATAATTGCTATGGCAGGACGGGACGCTGTAGCCTTCAATGGTGGCCCTGACATACAAATCCCTCTCGGCAGGAAGGATGCCGATTCCTCCAACGCTGGCG
AAGCAGATTCCAAACTCCCTCCTGCAACCTCTAGCATCGATAGAGTGTTCAACGTCTTTGGCCCTTTTGGCATGACTCCAGAGGAAATCGTGGCCATTCTAG
GTTCGCATTCATAGCCAA
ATCTTGCCTCATGTATAATATCTGACGAGATTTGCAAAGGTGCAGTCCCTTCACTGGTGACATGGTTTTTAACTCGAACTCCTGCTCTGCTGTAACGTAGGTGCGCACAGCATTGGAGTA
GGCCACTGCAAAAATATTCAAGACCGTCTGCAATCCAACAGTCCGACTGCGCCAAACAGCCTCGTGTTCCGCACTCAGCTCATGGCGGCTTGCGCAGTGAATGTCTTCGACATCGCCGTT
GTAAACAACGACGCCACTCAGTTCACCTTCGACAACCAGTACTTTCAAGATATTCAAAACGGGCGCGGTCTCTTCACCGTAGATCACCTGCTCAGCACAGATCCACGCACCGCGCCCATC
GTTAACACCTACGCCTCCAACGAAGGTGCCTTCTTTGCGTCGTTTGCGTCGGCTTATGTGAAACTTACGTCGCGAGCAGTGACAGGGAATCGAGGCAGCGTCAGAAGCACATGCCAGCTT
TAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGGCTGGACTGCAGCACTGCTTGGGGCGGCGGCAGCTGGAGTATATATGGTTCTGTTTCTAGGGACAACAGTTCATGCGGAGCTGCAATACGGGTATTATGATAGCTTGGGATGC
GCCGGGGTGGAAGATAGAGTGCGAACTTTAGTGCAGCGCAGCTTTGTCGCTGATGCTACAGCTAGTGCTGCCATGTTGCGCCTTGCCTTCCACGACTGCCAAGTTGGACCG
GGAGGATGC
GATGCCTCCATCATGATCGATGAGGATGCGGGAGAGATGGCCTCCGGAAACAATTTTGGCATTAAGCGCCTCGATATCATCAACTCAGTGAAAGCCGACATGGAGGACAATTGCCCAAAT
ACAGTTTCTTGCGCAGACATAATTGCTATGGCAGGACGGGACGCTGTAGCCTTCAATGGTGGCCCTGACATACAAATCCCTCTCGGCAGGAAGGATGCCGATTCCTCCAACGCTGGCGAA
GCAGATTCCAAACTCCCTCCTGCAACCTCTAGCATCGATAGAGTGTTCAACGTCTTTGGCCCTTTTGGCATGACTCCAGAGGAAATCGTGGCCATTCTAG
GTGCGCACAGCATTGGAGTA
GGCCACTGCAAAAATATTCAAGACCGTCTGCAATCCAACAGTCCGACTGCGCCAAACAGCCTCGTGTTCCGCACTCAGCTCATGGCGGCTTGCGCAGTGAATGTCTTCGACATCGCCGTT
GTAAACAACGACGCCACTCAGTTCACCTTCGACAACCAGTACTTTCAAGATATTCAAAACGGGCGCGGTCTCTTCACCGTAGATCACCTGCTCAGCACAGATCCACGCACCGCGCCCATC
GTTAACACCTACGCCTCCAACGAAGGTGCCTTCTTTGCGTCGTTTGCGTCGGCTTATGTGAAACTTACGTCGCGAGCAGTGACAGGGAATCGAGGCAGCGTCAGAAGCACATGCCAGCTT
TAG

Retrieve as FASTA