Entry information : MtPrx06 (Medtr2g008710.1 [4.0] / Medtr2g008710.1 [3.5] / Medtr2g008770.1 [3.0])
Entry ID 333
Creation 2009-01-05 (Christophe Dunand)
Last sequence changes 2010-09-14 (Haythem Mhadhbi)
Sequence status complete
Reviewer Harold Duruflé
Last annotation changes 2016-06-17 (Harold Duruflé)
Peroxidase information: MtPrx06 (Medtr2g008710.1 [4.0] / Medtr2g008710.1 [3.5] / Medtr2g008770.1 [3.0])
Name (synonym) MtPrx06 (Medtr2g008710.1 [4.0] / Medtr2g008710.1 [3.5] / Medtr2g008770.1 [3.0])
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Cell culture
Leaves
Mycorrhizal roots
Roots
Shoots
Young leaves
Inducers Cadmium treatment
Elicitor treatment (glucan, oligosaccharides, yeast extract, Phytophthora crude extract)
Glomus intraradices infection
Mycorrhiza
Nodulation
Pathogen interaction
Phoma infection
Sinorhizobium inoculation
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx06
start..stop
S start..stop
MtPrx[P]06 577 0 1..325 1..315
AhPrx05 535 0 1..325 1..330
LjPrx07 533 0 1..325 1..326
GmPrx256 522 0 1..325 1..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1585133..1585528 396 N° 2 1584666..1584828 163 N° 3 1584151..1584569 419  
complement(join(1584151..1584569,1584666..1584828,1585133..1585528))


exon

Literature and cross-references MtPrx06 (Medtr2g008710.1 [4.0] / Medtr2g008710.1 [3.5] / Medtr2g008770.1 [3.0])
Literature Torres-Jerez,I. et al., unpublished
DNA ref. Phytozome 11:   chr2 (1585528..1584151)
Cluster/Prediction ref. Phytozome Gene 11:   31068989 UniGene:   Mtr.14683 [5' end]   Mtr.4002 [3' end]
Omic ref. Gene atlas:   Mtr.40911.1.S1_s_at Legoo:   Mtr.40911.1.S1_s_at
Protein sequence: MtPrx06 (Medtr2g008710.1 [4.0] / Medtr2g008710.1 [3.5] / Medtr2g008770.1 [3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (301)
PWM (Da):   %s   34522.38 (31852.9) Transmb domain:   %s   i5-27o
PI (pH):   %s   7.7 (7.70) Peptide Signal:   %s   cut: 25 range:25-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEGSLFKVVFLLLVFSIVNTLVYGQGTRVGFYSSTCSQAESIVKSTVASHVNSDSSLAPGLLRMHFHDCFVQGCDASVLVAGSGTEKTAFPNLGLRGFEVIEDAKTKLEAACPGVVSCADIVALAARDSVVLSGGLSWQVPTGRRDGRVSQASDVNNLPAPGDSVDEQKQKFATKGLNTQDLVTLVGGHTIGTTACQFFSNRLRNFTTNGAADPSIDPSFLSQLQTLCPQNSGATNRIALDTGSQNKFDNSYYANLRNGRGILQSDQALWNDASTKTFVQRYLGLRGLLGLTFNVEFGNSMVKMSNIGVKTGVDGEIRKICSAFN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, introns 2 and 3) and 13 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTTTGAGGTT GAACACTTGA TATACAATCA AGGGTGTTCA CAATATAAAT CAGATACAGA CTCTAAAGAC TAAAGAATTC CTAAGATATG AGCTTTGATA AGAAATTCTA AGTGAACTTT  GAAGTGTAGA ACAATTTCAG CAGAGTTTTG CCTCAGTTAA TTCTTGGTAT TGTTCTTATG AAACTTTGAG TCTTCACTCC TTTATATAGA GGTGTGAAAG AGACGTTGAA TTGCCAACAC  ATTCAAAATA GAGTCGTTTG AAGCTTTTGA TCAATCACCA ATGATCCTTT GCTTGATATG ATTATTGTCC TATGAAGGAT CAATTTCAAA TGTATTCTCA TTGAGAAGAA ACATTGTTGC  AGGCAGAGCT GTTTTTCTTG TCTTGTAGCA GAGACAAAAC AGAGTAGTGG AGATAGTGGT TGTACACTTC GTACAAACGT ACTATGTCAA CGCTCTTTGA AGAATTAGCA TCCAATGCCT  TTCAAAATAG CCGTTGTAAT ACTTTTTCAG TCTTCTGCAA TCTTCAGATG AGTTTGAATC CTTTAAACAA CTTTTGAAGC TTTAAGTTCC ATCTCCTGAT GAACTCCAGC TTCTGGTGAT  TCTCAGCTTC TGATGAACTT GTTTCTGATG ACGTCATCAC TTCATGAGCA CTTTATCTTC AGGAGCATTT TAACTTCAGG AGCAGTTTTT TTCAGACGCT TTAAGCTTCC CTTTTTGTTG  ATGTATTTGC TCTTTATTTG TTCTTCCAAG ACCTTTTTAA GATGTCAAAT TTTTGTCTAT AGTCCTGTAC ACTCGAACAA ATATTAGCAT ATCCAATTGA CAATTTTTAA TACTTTGTTA  TCATCAAAAC TCTTAAAGGT TATTATTGCT AAACACATTT TGTTCCAACA GTCCTGACAC TAGACGTTCC ACATCTGAGT ACTGTGTTTT TCTTGGTGAC AACCTTATCT CTTGGTCTTC  CAAAAGGCAA CCTACTCTCT CTCAGTCTAG TGCTGAAGCT GAATATAGAG GTGTTGCTAA TGTTGTATAT GAGTCTTGTT GGATTCGTAA TCTTTTACTG GAACTTCATT TCCCTATTCC  TCATGGCACT TTGGTGTATT GTGACAATGT TAGTGTCATC TATCTCTCTG GTAACCCTGT GCAACATCAA CGTACCAATC ATATTGAAAT GGACATTCAC TTTGTACTGG AAAAGTAGCT  CGTGGTCAGG CACGCGTACT TCATGTTCCT TCTCGACATC AGATTGCAGA TATCTTCACC AAAGGGCTTC CTCGCATTCT ATTTGATGAT TTTTGGACCA GTCTAAGTGT CCGTGAACCT  CTCACTTCGA CTGTGAGGGT GGGATATAAT AAAATATTGT CATAATTAGC TATAATTATT TCCCTTAATT ATATTGTATC ATAATTAAAT AGTTGACCAA ACGTTACACA ACAGTTATAT  ATATTCTATT CGGATGAATG AGAAACGCAA AAATTCCATT ATCTTACAAT CATATTATCC CATTCATCCA ATTATCTTTA GGCAAACAAA GTATCGTTTG ATTAGACACA TTCAAGTCAC  TATAAGATAA AGTATACCGC ACTTTTGACA TTCATACATA CACACACATT CATCCCCAAA AGTCTCACGC GGAAACTAAT TGTATTTTAG CTAGCATGCA TATATAATCA CCTCAAGACA  AATTAAGAGG GCCACCCCAG CCCATTATAT CCAAAAATCA TTTATATACA TGCCCTCCAC CCACAACACC ACTTGTAGTA ATTTGTATCT ATATCAGCAG TCTTTGTTTA CTATTTCTCT  TCTTTTTGAC CCTAAAAGTC CAAACCTTTC CATATAAATA CCTGCACAGC ATGCATGGCA TTGCATATTG CATTTCACTA CAATAAAATC ATTACATACA AACTCTTTAT ATGCACCTAA 
AGTCTTAAAC AGCTACATAT ATTCCATTCA TATAATTAAG CTTAACTCTT CTTGCAATCC TTTACAAAAA TATCATATAA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATATGT GGTTTTATTG ATTAGTTTGT ACTGTTGGCA TGTTTGCCAT TGAAGTGTAT AATATTTGTA GTCTTTTGTT TGTTTTCTTG TTCATACGAA ATATGTTGAA AATGAATATA  TTTTCATTTA TATATGCGGT TTGGTCCGAT TTTTAAAAAA ATCCAAAATT CAAATCGAAT TTCAAAAAAG AAAAATCCAA AATCATCAAA TTACAATATT CCGATTTTTA GATACTTTTG  AATACGGCAA ATTACACTGA ATTCTCTTAG AGTGTGTTTG GATGGGGGAA TGTTTTGAGG GAATGTATTG TTTTAAGGGA ATTCAAATAC TTTGGGGTGA ATTCCATTGT TTGGATAATA  ATTTGAAGTA TTTTCAAAAT GATGGAAATT TATGAAGTAT TTTGTTCAAG TTAAATTTAG AGAATTTTAA ATGACACCTA AAAGCTAAGA ATTTCAAATT TCTTCATTGT TGTTATTTTT  CATATTTTAC ATTTTGGTCC TCAAATTTTC CAAAAATTTT CAAATTGACC CAAAAAATTT CCAAAAAATT GCAAATTGGT CCCTCAAATT TTTCGAAAAT TATAATTTGA CCCCTCAATT  TTTTGAAATT TACATTTTGA CCCCTAATTT CAATTTTCAA ATTTGGCCCA AAAAAATTAA AATTTATAAA AGTTGCCCAA AAATGATGAC AATGAATTTT TTTATTACTT CATCCAAACA  AAAGAATTGA GAAATGAAAG TAATTTAATG GAATCATTTA AATTGCCTAG AATTCTAAAT TCTTTAAAAT TTCTCAATTA CCTCATCCAA ACACACTCTA AGAGAATTCA GTGTAATTGA  GGGTTTGTTT GGATGGAGGG TTTAGGAGGG GAGGGTTCAC TTTTCATTTT TAAATTACGG ACACTATGAA ATGTTTTTTA AAAAGTTAAA GGGGACTACA CTACTCTCGG TTTATGAAAG 
GAACTAACAT AAACTGCTTT GTGACTGTCT TTTCTTTCTA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGGTAGTTTGTTTAAGGTTGTGTTTCTTTTACTAGTTTTTAGTATTGTAAACACATTAGTGTATGGCCAAGGGACACGTGTAGGATTCTATTCAAGTACATGTTCTCAAGCAGAA
TCAATTGTTAAATCCACAGTTGCTTCTCATGTTAACTCTGATTCTTCTTTAGCTCCTGGTTTACTTAGGATGCACTTTCATGATTGTTTTGTCCAAGGTTGTGACGCTTCTGTTCTCGTT
GCCGGCTCAGGCACCGAGAAAACAGCATTTCCAAACCTTGGTTTAAGAGGTTTTGAAGTTATTGAGGATGCTAAGACAAAACTCGAGGCTGCATGTCCCGGTGTTGTCTCTTGTGCTGAT
ATCGTTGCTCTTGCTGCTCGTGATTCCGTTGTTCTG
GTAATTAACTAACTTAACTATATATTGTACAAATGATAGTAAAGGAGATACTGCTAAAAATGTTGAATTAATTAGTTACACAAA
TATAAATTTTATGTTCATGAATTTAGTCATTAATCTATTAGAACCGTCAAAATTAAAGATCAATATTCATTTTTTTTTTATATTAATAATTCAACCTTTTTAATAGTTCAAAATATTCGA
TCAATTATAAAATTGACATAAGTTGAATATATTACTTAGTGTAATAAGTTCTTAACTTGTTGAAATATGGACCTATAATTGATTTATGTATGCATTGTAGAGTGGTGGTCTTAGTTGGCA
AGTTCCTACCGGGCGCAGAGACGGACGCGTGTCACAGGCTTCTGATGTCAATAACTTGCCTGCTCCTGGTGATTCTGTTGATGAGCAGAAACAAAAGTTTGCAACAAAAGGCCTTAACAC
TCAAGACCTTGTCACCCTTGTTG
GTAAGAGATCTAAATATTTTCGAAATTTATTTATCACTCTAGAATTACATATTGATGTTGCATCACATTAATTAATATTTTATGAATATATTATAGG
TGGACATACAATTGGTACAACAGCATGTCAATTCTTCAGCAACAGATTGAGAAACTTCACTACAAATGGTGCAGCTGATCCTTCAATAGACCCTTCATTTCTTTCACAATTACAAACACT
TTGTCCTCAAAACAGTGGTGCTACAAACAGAATTGCATTGGATACTGGAAGTCAAAATAAATTTGATAATTCTTACTATGCTAATCTGAGGAACGGACGTGGAATTCTTCAATCTGATCA
AGCATTGTGGAATGATGCTTCCACAAAGACATTTGTGCAAAGATACTTGGGTCTAAGAGGGTTGCTTGGATTAACATTTAATGTTGAATTTGGAAATTCAATGGTAAAGATGAGCAACAT
TGGAGTGAAGACCGGTGTTGATGGTGAAATCCGCAAGATATGTTCTGCTTTCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGGTAGTTTGTTTAAGGTTGTGTTTCTTTTACTAGTTTTTAGTATTGTAAACACATTAGTGTATGGCCAAGGGACACGTGTAGGATTCTATTCAAGTACATGTTCTCAAGCAGAA
TCAATTGTTAAATCCACAGTTGCTTCTCATGTTAACTCTGATTCTTCTTTAGCTCCTGGTTTACTTAGGATGCACTTTCATGATTGTTTTGTCCAAGGTTGTGACGCTTCTGTTCTCGTT
GCCGGCTCAGGCACCGAGAAAACAGCATTTCCAAACCTTGGTTTAAGAGGTTTTGAAGTTATTGAGGATGCTAAGACAAAACTCGAGGCTGCATGTCCCGGTGTTGTCTCTTGTGCTGAT
ATCGTTGCTCTTGCTGCTCGTGATTCCGTTGTTCTG
AGTGGTGGTCTTAGTTGGCAAGTTCCTACCGGGCGCAGAGACGGACGCGTGTCACAGGCTTCTGATGTCAATAACTTGCCTGCT
CCTGGTGATTCTGTTGATGAGCAGAAACAAAAGTTTGCAACAAAAGGCCTTAACACTCAAGACCTTGTCACCCTTGTTG
GTGGACATACAATTGGTACAACAGCATGTCAATTCTTCAGC
AACAGATTGAGAAACTTCACTACAAATGGTGCAGCTGATCCTTCAATAGACCCTTCATTTCTTTCACAATTACAAACACTTTGTCCTCAAAACAGTGGTGCTACAAACAGAATTGCATTG
GATACTGGAAGTCAAAATAAATTTGATAATTCTTACTATGCTAATCTGAGGAACGGACGTGGAATTCTTCAATCTGATCAAGCATTGTGGAATGATGCTTCCACAAAGACATTTGTGCAA
AGATACTTGGGTCTAAGAGGGTTGCTTGGATTAACATTTAATGTTGAATTTGGAAATTCAATGGTAAAGATGAGCAACATTGGAGTGAAGACCGGTGTTGATGGTGAAATCCGCAAGATA
TGTTCTGCTTTCAACTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATTATGGCCG GGGGCATATT GCATTTCACT ACAATAAAAT CATTACATAC AAACTCTTTA TATGCACCTA AAGTCTTAAA CAGCTACATA TATTCCATTC ATATAATTAA GCTTAACTCT  TCTTGCAATC CTTTACAAAA ATATCATATA AATGGAGGGT AGTTTGTTTA AGGTTGTGTT TCTTTTACTA GTTTTTAGTA TTGTAAACAC ATTAGTGTAT GGCCAAGGGA CACGTGTAGG  ATTCTATTCA AGTACATGTT CTCAAGCAGA ATCAATTGTT AAATCCACAG TTGCTTCTCA TGTTAACTCT GATTCTTCTT TAGCTCCTGG TTTACTTAGG ATGCACTTTC ATGATTGTTT  TGTCCAAGGT TGTGACGCTT CTGTTCTCGT TGCCGGCTCA GGCACCGAGA AAACAGCATT TCCAAACCTT GGTTTAAGAG GTTTTGAAGT TATTGAGGAT GCTAAGACAA AACTCGAGGC  TGCATGTCCC GGTGTTGTCT CTTGTGCTGA TATCGTTGCT CTTGCTGCTC GTGATTCCGT TGTTCTGAGT GGTGGTCTTA GTTGGCAAGT TCCTACCGGG CGCAGAGACG GACGCGTGTC  ACAGGCTTCT GATGTCAATA ACTTGCCTGC TCCTGGTGAT TCTGTTGATG AGCAGAAACA AAAGTTTGCA ACAAAAGGCC TTAACACTCA AGACCTTGTC ACCCTTGTTG GTGGACATAC  AATTGGTACA ACAGCATGTC AATTCTTCAG CAACAGATTG AGAAACTTCA CTACAAATGG TGCAGCTGAT CCTTCAATAG ACCCTTCATT TCTTTCACAA TTACAAACAC TTTGTCCTCA  AAACAGTGGT GCTACAAACA GAATTGCATT GGATACTGGA AGTCAAAATA AATTTGATAA TTCTTACTAT GCTAATCTGA GGAACGGACG TGGAATTCTT CAATCTGATC AAGCATTGTG  GAATGATGCT TCCACAAAGA CATTTGTGCA AAGATACTTG GGTCTAAGAG GGTTGCTTGG ATTAACATTT AATGTTGAAT TTGGAAATTC AATGGTAAAG ATGAGCAACA TTGGAGTGAA  GACCGGTGTT GATGGTGAAA TCCGCAAGAT ATGTTCTGCT TTCAACTAAA TGCATATGTG GTTTTATTGA TTAGTTTGTA CTGTTGGCAT GTTTGCCATT GAAGTGTATA ATATTTGTAG 
TCTTTTGTTT GTTTTCTTGT TCATACGAAA TATGTTGAAA ATGAATATAT TTTCATTTAT ATAAAAAAAA A 

Retrieve as FASTA