Entry information : MtPrx07 (Medtr3g092990.1[4.0] / Medtr3g092990.1[3.5] / Medtr3g122440.1[3.0])
Entry ID 334
Creation 2006-06-22 (Christophe Dunand)
Last sequence changes 2010-09-15 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-07-15 (Christophe Dunand)
Peroxidase information: MtPrx07 (Medtr3g092990.1[4.0] / Medtr3g092990.1[3.5] / Medtr3g122440.1[3.0])
Name (synonym) MtPrx07 (Medtr3g092990.1[4.0] / Medtr3g092990.1[3.5] / Medtr3g122440.1[3.0])
Class Class III peroxidase    [Orthogroup: Prx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Beans
Mixed tissues
Root tips
Inducers Elicitor treatment (glucan, oligosaccharides, yeast extract, Phytophthora crude extract)
Insect damage (Spodoptera exigua, Meloidogyne, Aphib)
Nitrogen starvation
Sinorhizobium inoculation
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx07
start..stop
S start..stop
GmPrx09 577 0 1..327 1..327
CclPrx110 497 4e-179 1..326 3..328
MePrx120 495 2e-178 2..327 3..331
CsPrx21 494 5e-178 1..326 3..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 42504926..42505138 213 N° 2 42504578..42504769 192 N° 3 42504323..42504488 166 N° 4 42503820..42504232 413
complement(join(42503820..42504232,42504323..42504488,42504578..42504769,4250492 6..42505138))


exon

Literature and cross-references MtPrx07 (Medtr3g092990.1[4.0] / Medtr3g092990.1[3.5] / Medtr3g122440.1[3.0])
Literature Journet,E.P. et al., unpublished, Torres-Jerez,I. et al., unpublished.
Protein ref. UniProtKB:   Q1T6J6
DNA ref. Phytozome 11:   chr3 (42505138..42503820)
Cluster/Prediction ref. Phytozome Gene 11:   31056477
Omic ref. Gene atlas:   Mtr.51089.1.S1_at Legoo:   Mtr.51089.1.S1_at
Protein sequence: MtPrx07 (Medtr3g092990.1[4.0] / Medtr3g092990.1[3.5] / Medtr3g122440.1[3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa): %sProtein length in amino acid 327 (303)
PWM (Da): %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
35431.8 (32718.3)  
PI (pH): %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
8.2 (7.72) Peptide Signal: %sProtein signal for mature protein.
if exist :cut position of signal peptide.
range: start-end pos of mature protein
cut: 25 range:25-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNPKKLNYAIIVLVIYFLNGNAHSQLEVGFYTYSCGMAEFIVKDEVRKSFNKNPGIAAGLVRMHFHDCFIRGCDASVLLDSTLSNIAEKDSPANKPSLRGFEVIDNAKAKLEEECKGIVSCADIVAFAARDSVELAGGLGYDVPAGRRDGKISLASDTRTELPPPTFNVNQLTQLFAKKGLTQDEMVTLSGAHTIGRSHCSAFSKRLYNFSSTSIQDPSLDPSYAALLKRQCPQGNTNQNLVVPMDPSSPGTADVGYYNDILANRGLFTSDQTLLTNTGTARKVHQNARNPYLWSNKFADAMVKMGQVGVLTGNAGEIRTNCRVVNS

Retrieve as FASTA  
Remarks Complete sequence from genomic (Chromo 3, 3 introns) and 8 ESTs. Second transcript prediction from Phytozome witout FHDC.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATCCGAAAAAACTTAATTATGCAATTATAGTTTTGGTCATATATTTTTTGAATGGAAATGCTCATTCTCAGCTGGAGGTTGGGTTTTATACTTATTCATGTGGCATGGCTGAGTTC
ATTGTAAAAGATGAGGTCCGAAAAAGTTTCAATAAGAATCCTGGAATTGCTGCTGGACTTGTAAGAATGCATTTTCATGATTGCTTTATCAGA
GTAAGTTATAATTAAAAGCCATTTGTA
ACGTAATGTTGCACCTTGCACACAATGCTTAGTAGTTGTTCGTTCATTAAGATATACATTTTGGAAATCACCAACGCAATTAAAAGCCATTTTGTGACGCCATTAACTTAACCGTATTGT
TAATTGTAGGGGTGTGACGCATCGGTACTTCTCGATTCTACTCTCTCAAACATTGCAGAGAAAGACTCTCCAGCCAATAAACCAAGTCTCAGAGGGTTTGAAGTTATTGATAATGCAAAG
GCTAAACTTGAAGAAGAATGCAAAGGAATTGTTTCATGTGCTGACATAGTTGCATTTGCAGCAAGGGATAGTGTGGAGTTG
GTAAGTGTATCTACTTTGTTTGTGCTAGAAACATTTGAA
GGTAAGTTCTTATTTCAGAAGGACCCTAAATCATTCCTTATTTCATGCAGGCTGGAGGGCTTGGCTATGATGTTCCTGCGGGAAGAAGAGATGGGAAAATATCACTAGCTTCAGATACAA
GAACAGAATTACCTCCTCCAACTTTCAATGTTAACCAACTCACTCAACTCTTTGCAAAGAAGGGGTTAACACAAGATGAAATGGTCACTCTCTCTG
GTAGGATTTTCATGATAATTAATT
AACACTTTTGAGATTGTTTATCTTATAGCTTAAATTTGTATGAAGCGTGTATTTTTGTTTATGCAGGTGCACACACCATTGGTCGGTCTCATTGCTCCGCTTTCAGCAAGAGATTATACA
ACTTCAGCAGCACTTCAATCCAGGATCCAAGTTTAGATCCCTCATATGCTGCACTATTGAAGAGGCAATGTCCACAAGGCAACACAAACCAAAACTTGGTGGTTCCAATGGACCCCTCTA
GCCCTGGAACTGCAGATGTAGGATACTATAATGATATATTGGCAAATAGAGGCTTGTTCACTTCTGATCAGACTCTCTTAACCAACACTGGAACAGCCAGAAAAGTTCATCAAAATGCCA
GGAATCCATATCTATGGTCAAACAAATTTGCAGATGCAATGGTAAAGATGGGACAGGTCGGTGTCTTGACAGGTAATGCTGGAGAGATTAGGACAAATTGCAGGGTGGTCAATAGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATCCGAAAAAACTTAATTATGCAATTATAGTTTTGGTCATATATTTTTTGAATGGAAATGCTCATTCTCAGCTGGAGGTTGGGTTTTATACTTATTCATGTGGCATGGCTGAGTTC
ATTGTAAAAGATGAGGTCCGAAAAAGTTTCAATAAGAATCCTGGAATTGCTGCTGGACTTGTAAGAATGCATTTTCATGATTGCTTTATCAGA
GGGTGTGACGCATCGGTACTTCTCGAT
TCTACTCTCTCAAACATTGCAGAGAAAGACTCTCCAGCCAATAAACCAAGTCTCAGAGGGTTTGAAGTTATTGATAATGCAAAGGCTAAACTTGAAGAAGAATGCAAAGGAATTGTTTCA
TGTGCTGACATAGTTGCATTTGCAGCAAGGGATAGTGTGGAGTTG
GCTGGAGGGCTTGGCTATGATGTTCCTGCGGGAAGAAGAGATGGGAAAATATCACTAGCTTCAGATACAAGAACA
GAATTACCTCCTCCAACTTTCAATGTTAACCAACTCACTCAACTCTTTGCAAAGAAGGGGTTAACACAAGATGAAATGGTCACTCTCTCTG
GTGCACACACCATTGGTCGGTCTCATTGC
TCCGCTTTCAGCAAGAGATTATACAACTTCAGCAGCACTTCAATCCAGGATCCAAGTTTAGATCCCTCATATGCTGCACTATTGAAGAGGCAATGTCCACAAGGCAACACAAACCAAAAC
TTGGTGGTTCCAATGGACCCCTCTAGCCCTGGAACTGCAGATGTAGGATACTATAATGATATATTGGCAAATAGAGGCTTGTTCACTTCTGATCAGACTCTCTTAACCAACACTGGAACA
GCCAGAAAAGTTCATCAAAATGCCAGGAATCCATATCTATGGTCAAACAAATTTGCAGATGCAATGGTAAAGATGGGACAGGTCGGTGTCTTGACAGGTAATGCTGGAGAGATTAGGACA
AATTGCAGGGTGGTCAATAGCTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGACCACAAA GAGATATAGT ATTCAGTGAA AATGAATCCG AAAAAACTTA ATTATGCAAT TATAGTTTTG GTCATATATT TTTTGAATGG AAATGCTCAT TCTCAGCTGG AGGTTGGGTT  TTATACTTAT TCATGTGGCA TGGCTGAGTT CATTGTAAAA GATGAGGTCC GAAAAAGTTT CAATAAGAAT CCTGGAATTG CTGCTGGACT TGTAAGAATG CATTTTCATG ATTGCTTTAT  CAGAGGGTGT GACGCATCGG TACTTCTCGA TTCTACTCTC TCAAACATTG CAGAGAAAGA CTCTCCAGCC AATAAACCAA GTCTCAGAGG GTTTGAAGTT ATTGATAATG CAAAGGCTAA  ACTTGAAGAA GAATGCAAAG GAATTGTTTC ATGTGCTGAC ATAGTTGCAT TTGCAGCAAG GGATAGTGTG GAGTTGGCTG GAGGGCTTGG CTATGATGTT CCTGCGGGAA GAAGAGATGG  GAAAATATCA CTAGCTTCAG ATACAAGAAC AGAATTACCT CCTCCAACTT TCAATGTTAA CCAACTCACT CAACTCTTTG CAAAGAAGGG GTTAACACAA GATGAAATGG TCACTCTCTC  TGGTGCACAC ACCATTGGTC GGTCTCATTG CTCCGCTTTC AGCAAGAGAT TATACAACTT CAGCAGCACT TCAATCCAGG ATCCAAGTTT AGATCCCTCA TATGCTGCAC TATTGAAGAG  GCAATGTCCA CAAGGCAACA CAAACCAAAA CTTGGTGGTT CCAATGGACC CCTCTAGCCC TGGAACTGCA GATGTAGGAT ACTATAATGA TATATTGGCA AATAGAGGCT TGTTCACTTC  TGATCAGACT CTCTTAACCA ACACTGGAAC AGCCAGAAAA GTTCATCAAA ATGCCAGGAA TCCATATCTA TGGTCAAACA AATTTGCAGA TGCAATGGTA AAGATGGGAC AGGTCGGTGT  CTTGACAGGT AATGCTGGAG AGATTAGGAC AAATTGCAGG GTGGTCAATA GCTAGATATG GTGTTGAAGG ACTGAAGTTC CTGCAGTATT AAAGATTTTA TTAATTCTGT TGTGTTTCAT  TTGGTTTTGG CTACTTAATT ACATAGCCAA CAACTTTGCT TTGGTTTATT TTCTGTGTAA CTGTGGCATT CATTTGTGAG TTGATTGTGG CCCTTCTACT TTTCTTGAAA TACACAGCTT 
GTAGCCTTGT CATATGCAAC AAGAATTTAC CCATGTTATC GAATAAATTC TTCTGTATGC ATAATTGC 

Retrieve as FASTA