Entry information : MtPrx08 (Medtr5g022870.1 [4.0] / Medtr5g022870.1 [3.5] / Medtr5g022850.1 [3.0])
Entry ID 335
Creation 2006-06-22 (Christophe Dunand)
Last sequence changes 2010-09-15 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-07-15 (Christophe Dunand)
Peroxidase information: MtPrx08 (Medtr5g022870.1 [4.0] / Medtr5g022870.1 [3.5] / Medtr5g022850.1 [3.0])
Name (synonym) MtPrx08 (Medtr5g022870.1 [4.0] / Medtr5g022870.1 [3.5] / Medtr5g022850.1 [3.0])
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Cotyledons
Flowers
Germinating seeds
Glandular trichome
Immature pods
Leaves
Shoots
Stems
Inducers Colletotrichum inoculation
Insect damage (Spodoptera exigua, Meloidogyne, Aphib)
Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx08
start..stop
S start..stop
GmPrx06 572 0 1..316 1..316
GmPrx88 571 0 1..316 1..317
LjPrx29 536 0 1..316 1..316
MtPrx92 516 0 17..316 20..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9058839..9059042 204 N° 2 9058524..9058712 189 N° 3 9058215..9058377 163 N° 4 9057716..9058110 395
complement(join(9057716..9058110,9058215..9058377,9058524..9058712,9058839..9059 042))


exon

Literature and cross-references MtPrx08 (Medtr5g022870.1 [4.0] / Medtr5g022870.1 [3.5] / Medtr5g022850.1 [3.0])
Literature Fedorova,M. et al.,unpublished, Grusak,M.A. et al., unpublished.
DNA ref. Phytozome 11:   chr5 (9059042..9057716)
Cluster/Prediction ref. Phytozome Gene 11:   31087928 UniGene:   Mtr.12694
Omic ref. Gene atlas:   Mtr.14592.1.S1_at   Mtr.29089.1.S1_at Legoo:   Mtr.14592.1.S1_at
Protein sequence: MtPrx08 (Medtr5g022870.1 [4.0] / Medtr5g022870.1 [3.5] / Medtr5g022850.1 [3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa): %sProtein length in amino acid 316 (297)
PWM (Da): %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
34443.72 (32364.6)  
PI (pH): %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
9.83 (9.83) Peptide Signal: %sProtein signal for mature protein.
if exist :cut position of signal peptide.
range: start-end pos of mature protein
cut: 20 range:20-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVMVTFLNLIIIFSVVSTGKSLSLNYYEKSCHDLEYIVLKTVTDATARDKTVPAALLRMHFHDCFVRGCDASVLLNSKGKNKAEKDGPPNISLHAFYVIDEAKKALEAKCPGVVSCADILALAARDAVYLSGGPKWNVPKGRKDGRTSKASETRQLPAPTFNISQLQQSFSQRALSVEDLVALSGGHTLGFSHCSSFQNRIQNFNATHDVDPSLHQSFAAKLKSICPLKNKAKNAGTTMDPSATNFDNTYYKLILQQKGLFSSDQALLDSPKTKQLVSKFAASQKAFFDAFAKSMIKMSSINGGQEVRKDCRKIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, 3 introns) and 27 ESTs (TC114005: frame shift, TC133990: intron 1!!, TC133990: genomic!!).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTCATGGTTACATTCTTGAATTTGATTATCATTTTTTCAGTGGTTTCTACAGGAAAATCACTCAGCTTAAACTACTATGAAAAATCATGCCATGATCTGGAGTATATAGTTTTG
AAGACTGTGACGGATGCTACTGCTAGGGACAAAACTGTTCCAGCAGCACTTCTCCGAATGCACTTCCATGATTGCTTCGTTCGA
GTATTGCTATATTGAACTCCTTTCTTCTTGACATTG
TTTTTTTCCTTTTCTGTTTCCTTTTCCCGCACACCATCTATAAATTTGATTTTTCATTTGCATGTGTCGTTTTTTCCTATACTTTTGAAGGGGTGTGATGCATCTGTGCTGCTAAATTCA
AAAGGAAAAAACAAAGCAGAAAAGGATGGACCGCCAAACATTTCATTGCATGCATTCTATGTCATTGATGAAGCAAAGAAAGCATTAGAAGCTAAATGCCCTGGTGTAGTTTCTTGTGCT
GATATTCTTGCTCTCGCAGCAAGGGACGCAGTTTATCTG
GTAATAAAACAAAGCCAAGAACCAAAGCTCTCTTTCATTGAGACTCTGTTATGCTGTTTACTTTAGAATTGAAACATGTAG
ATATGGAAACTTGTATTTGTAAGTTTCAACTGATAACTGATGGTACATCTATGTATATTCTACAGTCTGGAGGACCTAAATGGAATGTTCCAAAAGGAAGAAAAGATGGAAGAACATCTA
AGGCCAGTGAAACAAGACAATTACCAGCACCAACATTCAACATATCACAGCTGCAGCAAAGCTTCTCACAAAGAGCATTGTCTGTGGAAGACTTGGTAGCTCTGTCAG
GTAAGCTATTCC
TAAAGTTAAAAAACATCAAAACTTCACCATTTTTCATGCTTTCATTTATATCTTAATGGAGTTTGAAGTAACATGTTTTGACCCATATGTAGGAGGGCATACCTTAGGCTTCTCTCACTG
CTCATCTTTCCAGAACAGAATCCAAAACTTTAATGCTACACATGACGTGGACCCTTCGTTACATCAATCATTTGCAGCAAAACTAAAATCAATTTGTCCGTTGAAAAATAAGGCCAAAAA
TGCTGGCACCACTATGGACCCTTCTGCAACAAATTTCGATAATACATATTACAAGTTGATCCTCCAACAAAAAGGCTTGTTTTCTTCTGATCAGGCTTTGCTTGACAGCCCAAAGACCAA
GCAATTGGTTTCTAAGTTTGCCGCCTCACAAAAGGCTTTCTTTGATGCTTTTGCCAAGTCCATGATAAAAATGAGTAGTATCAATGGTGGGCAAGAAGTTAGGAAGGACTGCAGAAAGAT
CAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTCATGGTTACATTCTTGAATTTGATTATCATTTTTTCAGTGGTTTCTACAGGAAAATCACTCAGCTTAAACTACTATGAAAAATCATGCCATGATCTGGAGTATATAGTTTTG
AAGACTGTGACGGATGCTACTGCTAGGGACAAAACTGTTCCAGCAGCACTTCTCCGAATGCACTTCCATGATTGCTTCGTTCGA
GGGTGTGATGCATCTGTGCTGCTAAATTCAAAAGGA
AAAAACAAAGCAGAAAAGGATGGACCGCCAAACATTTCATTGCATGCATTCTATGTCATTGATGAAGCAAAGAAAGCATTAGAAGCTAAATGCCCTGGTGTAGTTTCTTGTGCTGATATT
CTTGCTCTCGCAGCAAGGGACGCAGTTTATCTG
TCTGGAGGACCTAAATGGAATGTTCCAAAAGGAAGAAAAGATGGAAGAACATCTAAGGCCAGTGAAACAAGACAATTACCAGCACCA
ACATTCAACATATCACAGCTGCAGCAAAGCTTCTCACAAAGAGCATTGTCTGTGGAAGACTTGGTAGCTCTGTCAG
GAGGGCATACCTTAGGCTTCTCTCACTGCTCATCTTTCCAGAAC
AGAATCCAAAACTTTAATGCTACACATGACGTGGACCCTTCGTTACATCAATCATTTGCAGCAAAACTAAAATCAATTTGTCCGTTGAAAAATAAGGCCAAAAATGCTGGCACCACTATG
GACCCTTCTGCAACAAATTTCGATAATACATATTACAAGTTGATCCTCCAACAAAAAGGCTTGTTTTCTTCTGATCAGGCTTTGCTTGACAGCCCAAAGACCAAGCAATTGGTTTCTAAG
TTTGCCGCCTCACAAAAGGCTTTCTTTGATGCTTTTGCCAAGTCCATGATAAAAATGAGTAGTATCAATGGTGGGCAAGAAGTTAGGAAGGACTGCAGAAAGATCAATTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCAGGCATA TGGCGGGACA GATAGCAACA GCTAAAAAAT AATCAAAGTA CTCTTAATTG ACATGGCTGT CATGGTTACA TTCTTGAATT TGATTATCAT TTTTTCAGTG GTTTCTACAG  GAAAATCACT CAGCTTAAAC TACTATGAAA AATCATGCCA TGATCTGGAG TATATAGTTT TGAAGACTGT GACGGATGCT ACTGCTAGGG ACAAAACTGT TCCAGCAGCA CTTCTCCGAA  TGCACTTCCA TGATTGCTTC GTTCGAGGGT GTGATGCATC TGTGCTGCTA AATTCAAAAG GAAAAAACAA AGCAGAAAAG GATGGACCGC CAAACATTTC ATTGCATGCA TTCTATGTCA  TTGATGAAGC AAAGAAAGCA TTAGAAGCTA AATGCCCTGG TGTAGTTTCT TGTGCTGATA TTCTTGCTCT CGCAGCAAGG GACGCAGTTT ATCTGTCTGG AGGACCTAAA TGGAATGTTC  CAAAAGGAAG AAAAGATGGA AGAACATCTA AGGCCAGTGA AACAAGACAA TTACCAGCAC CAACATTCAA CATATCACAG CTGCAGCAAA GCTTCTCACA AAGAGCATTG TCTGTGGAAG  ACTTGGTAGC TCTGTCAGGA GGGCATACCT TAGGCTTCTC TCACTGCTCA TCTTTCCAGA ACAGAATCCA AAACTTTAAT GCTACACATG ACGTGGACCC TTCGTTACAT CAATCATTTG  CAGCAAAACT AAAATCAATT TGTCCGTTGA AAAATAAGGC CAAAAATGCT GGCACCACTA TGGACCCTTC TGCAACAAAT TTCGATAATA CATATTACAA GTTGATCCTC CAACAAAAAG  GCTTGTTTTC TTCTGATCAG GCTTTGCTTG ACAGCCCAAA GACCAAGCAA TTGGTTTCTA AGTTTGCCGC CTCACAAAAG GCTTTCTTTG ATGCTTTTGC CAAGTCCATG ATAAAAATGA  GTAGTATCAA TGGTGGGCAA GAAGTTAGGA AGGACTGCAG AAAGATCAAT TAAAAAGCCT TAATTTAGTT GAAGTTAATT ATGATATTTC AGACAAATTA TTGTGTGAAA AGTGGTGAAT  CACATTTTGA AGATGGTAAT AAAATTGTGT GTTTTCATTT ATAGAGATAT GTATTCTTTT TTTGCTTTTT AAGAAGCAGA GATATGTATT CTTATATCAG TGTTATAAAA ATTCAAACTT 
GTCTTGGCG 

Retrieve as FASTA