Entry information : MtPrx12 (Medtr2g029815.1 [4.0] / Medtr2g029820.1 [3.5] / AC234842_18.1)
Entry ID 339
Creation 2005-06-16 (Christophe Dunand)
Last sequence changes 2016-04-07 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-04-07 (Catherine Mathe)
Peroxidase information: MtPrx12 (Medtr2g029815.1 [4.0] / Medtr2g029820.1 [3.5] / AC234842_18.1)
Name (synonym) MtPrx12 (Medtr2g029815.1 [4.0] / Medtr2g029820.1 [3.5] / AC234842_18.1)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Leaves
Nodules
Roots nodules
Seedlings
Inducers Elicitor treatment (glucan, oligosaccharides, yeast extract, Phytophthora crude extract)
Phosphate starvation
Rhizobium inoculation
UV irradiation
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx12
start..stop
S start..stop
MsPrx02 649 0 1..352 1..355
MtPrx11 645 0 1..352 1..355
PsPrx09 626 0 19..352 17..353
MtPrx10 590 0 1..352 1..353
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11144936..11145157 222 N° 2 11145249..11145440 192 N° 3 11145545..11145710 166 N° 4 11145796..11146274 479
join(11144936..11145157,11145249..11145440,11145545..11145710,11145796..11146274 )


exon

Literature and cross-references MtPrx12 (Medtr2g029815.1 [4.0] / Medtr2g029820.1 [3.5] / AC234842_18.1)
Literature Liu,J. et al., unpublished.
Protein ref. UniProtKB:   A0A072VFU7
DNA ref. Phytozome 11:   chr2 (11144936..11146274)
Cluster/Prediction ref. Phytozome Gene 11:   31068057
Omic ref. Gene atlas:   Mtr.40124.1.S1_at Legoo:   Mtr.40124.1.S1_at
Protein sequence: MtPrx12 (Medtr2g029815.1 [4.0] / Medtr2g029820.1 [3.5] / AC234842_18.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   353 (325)
PWM (Da):   %s   37824.06 (34877.5) Transmb domain:   %s   i7-24o
PI (pH):   %s   7.66 (7.31) Peptide Signal:   %s   cut: 28 range:28-352
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNSLRAVAIALCFIVALFGVLPFPSNAQLNPSFYSKTCPNVSSIVREVIRNVSKTDTRMLASLVRLHFHDCFVQGCDASVLLNNTATIVSEQDAFPNRNSLRGLDVVNQIKTAVEKACPNTVSCADILALAAELSSTLSQGPDWKVPLGRRDGLTANQSLANQNLPAPFNSLDQLKAAFASQGLSTTDLVALSGAHTFGRAHCSLFVSRLYNFSNTGSPDPTLNATYLQQLRNICPNGGPGTPLASFDPTTPDKFDKNYYSNLQVKKGLLQSDQELFSTSGADTISIVNNFATDQKAFFESFKAAMIKMGNIGVLTGNQGEIRKQCNFVNSKSVELGLVNVASTEEGMVSSM

Retrieve as FASTA  
Remarks Complete sequence from 11 ESTs and genomic sequence (chromo 2, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAACTCTCTTCGTGCTGTAGCAATAGCTTTGTGTTTTATTGTGGCTTTGTTTGGAGTGTTACCTTTCCCTTCCAATGCACAACTTAATCCATCCTTTTATAGCAAAACTTGTCCAAAT
GTTAGTTCCATTGTCCGGGAAGTCATAAGAAACGTTTCTAAGACAGATACTCGTATGCTTGCAAGTCTTGTTAGGCTTCACTTCCATGACTGTTTTGTTCAA
GTATGTATACTTTACCTT
CTACTTGTAAATGATTTGTATTATGCTAATGTTATAATCATAATGTAAATAATGTAATCTATGACTTGAACAGGGTTGTGATGCATCAGTTTTGTTGAATAACACTGCTACTATTGTCAG
TGAACAAGATGCTTTTCCAAACAGAAACTCATTGAGAGGTTTGGATGTTGTGAATCAAATCAAAACAGCAGTAGAAAAGGCTTGCCCTAACACAGTTTCTTGTGCTGATATTCTTGCTCT
TGCTGCTGAATTATCATCTACACTG
GTATATATATGCCTCATCCTTTATTATATAGTATTTTTATCCACCATTGAATTTCAAATGGAAATTCTTATTGACTCTTTTTGTTTTGTGATGTA
ATAAAATAGTCTCAAGGTCCTGATTGGAAAGTTCCTTTAGGAAGAAGAGATGGTTTAACAGCAAACCAATCACTTGCTAATCAAAATCTTCCAGCTCCTTTTAACTCATTAGATCAACTC
AAAGCTGCATTTGCTTCTCAAGGCCTCAGTACTACTGATCTAGTTGCACTCTCGG
GTATGTAACATTTTTAAAGTTTTTGTTTAAAAATTTCTAATTAGTAGTATGTATGATTATTGATC
TATATCTGTTTCAATTGCAGGTGCTCATACATTTGGAAGAGCTCATTGCTCTTTATTTGTTAGTCGATTGTACAACTTCAGCAATACGGGAAGTCCCGATCCAACTCTTAACGCAACTTA
CTTACAACAATTGCGCAATATATGTCCCAATGGTGGACCTGGAACTCCCCTTGCAAGTTTTGATCCAACTACTCCTGATAAATTTGACAAGAACTATTACTCTAATCTTCAAGTGAAAAA
AGGTTTGCTTCAAAGTGATCAAGAGTTGTTCTCAACATCTGGTGCTGATACCATTAGCATTGTCAACAACTTTGCCACTGATCAAAAAGCTTTTTTTGAGAGCTTTAAGGCTGCTATGAT
TAAAATGGGAAATATTGGTGTGTTAACCGGGAACCAAGGAGAGATTAGAAAACAATGCAACTTTGTTAATTCAAAATCAGTAGAACTAGGTCTTGTCAATGTTGCCTCAACAGAGGAGGG
TATGGTTAGCTCAATGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAACTCTCTTCGTGCTGTAGCAATAGCTTTGTGTTTTATTGTGGCTTTGTTTGGAGTGTTACCTTTCCCTTCCAATGCACAACTTAATCCATCCTTTTATAGCAAAACTTGTCCAAAT
GTTAGTTCCATTGTCCGGGAAGTCATAAGAAACGTTTCTAAGACAGATACTCGTATGCTTGCAAGTCTTGTTAGGCTTCACTTCCATGACTGTTTTGTTCAA
GGTTGTGATGCATCAGTT
TTGTTGAATAACACTGCTACTATTGTCAGTGAACAAGATGCTTTTCCAAACAGAAACTCATTGAGAGGTTTGGATGTTGTGAATCAAATCAAAACAGCAGTAGAAAAGGCTTGCCCTAAC
ACAGTTTCTTGTGCTGATATTCTTGCTCTTGCTGCTGAATTATCATCTACACTG
TCTCAAGGTCCTGATTGGAAAGTTCCTTTAGGAAGAAGAGATGGTTTAACAGCAAACCAATCACTT
GCTAATCAAAATCTTCCAGCTCCTTTTAACTCATTAGATCAACTCAAAGCTGCATTTGCTTCTCAAGGCCTCAGTACTACTGATCTAGTTGCACTCTCGG
GTGCTCATACATTTGGAAGA
GCTCATTGCTCTTTATTTGTTAGTCGATTGTACAACTTCAGCAATACGGGAAGTCCCGATCCAACTCTTAACGCAACTTACTTACAACAATTGCGCAATATATGTCCCAATGGTGGACCT
GGAACTCCCCTTGCAAGTTTTGATCCAACTACTCCTGATAAATTTGACAAGAACTATTACTCTAATCTTCAAGTGAAAAAAGGTTTGCTTCAAAGTGATCAAGAGTTGTTCTCAACATCT
GGTGCTGATACCATTAGCATTGTCAACAACTTTGCCACTGATCAAAAAGCTTTTTTTGAGAGCTTTAAGGCTGCTATGATTAAAATGGGAAATATTGGTGTGTTAACCGGGAACCAAGGA
GAGATTAGAAAACAATGCAACTTTGTTAATTCAAAATCAGTAGAACTAGGTCTTGTCAATGTTGCCTCAACAGAGGAGGGTATGGTTAGCTCAATGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAATC TCAAACTCAA TCTCACAACA AAAATGAACT CTCTTCGTGC TGTAGCAATA GCTTTGTGTT TTATTGTGGC TTTGTTTGGA GTGTTACCTT TCCCTTCCAA TGCACAACTT  AATCCATCCT TTTATAGCAA AACTTGTCCA AATGTTAGTT CCATTGTCCG GGAAGTCATA AGAAACGTTT CTAAGACAGA TACTCGTATG CTTGCAAGTC TTGTTAGGCT TCACTTCCAT  GACTGTTTTG TTCAAGGTTG TGATGCATCA GTTTTGTTGA ATAACACTGC TACTATTGTC AGTGAACAAG ATGCTTTTCC AAACAGAAAC TCATTGAGAG GTTTGGATGT TGTGAATCAA  ATCAAAACAG CAGTAGAAAA GGCTTGCCCT AACACAGTTT CTTGTGCTGA TATTCTTGCT CTTGCTGCTG AATTATCATC TACACTGTCT CAAGGTCCTG ATTGGAAAGT TCCTTTAGGA  AGAAGAGATG GTTTAACAGC AAACCAATCA CTTGCTAATC AAAATCTTCC AGCTCCTTTT AACTCATTAG ATCAACTCAA AGCTGCATTT GCTTCTCAAG GCCTCAGTAC TACTGATCTA  GTTGCACTCT CGGGTGCTCA TACATTTGGA AGAGCTCATT GCTCTTTATT TGTTAGTCGA TTGTACAACT TCAGCAATAC GGGAAGTCCC GATCCAACTC TTAACGCAAC TTACTTACAA  CAATTGCGCA ATATATGTCC CAATGGTGGA CCTGGAACTC CCCTTGCAAG TTTTGATCCA ACTACTCCTG ATAAATTTGA CAAGAACTAT TACTCTAATC TTCAAGTGAA AAAAGGTTTG  CTTCAAAGTG ATCAAGAGTT GTTCTCAACA TCTGGTGCTG ATACCATTAG CATTGTCAAC AACTTTGCCA CTGATCAAAA AGCTTTTTTT GAGAGCTTTA AGGCTGCTAT GATTAAAATG  GGAAATATTG GTGTGTTAAC CGGGAACCAA GGAGAGATTA GAAAACAATG CAACTTTGTT AATTCAAAAT CAGTAGAACT AGGTCTTGTC AATGTTGCCT CAACAGAGGA GGGTATGGTT 
AGCTCAATGT AAATGTAGTG ACTGGAGCCC AAATATAAAT AAGCTATAAC TAGGCACATT CATGGGTATG TGTTACATAT CCTT 

Retrieve as FASTA