Entry information : HjCcP01
Entry ID 3390
Creation 2006-07-25 (Christophe Dunand)
Last sequence changes 2013-04-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-06 (Catherine Mathe (Scipio))
Peroxidase information: HjCcP01
Name HjCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Hypocreaceae Hypocrea
Organism Hypocrea jecorina (Trichoderma reesei)    [TaxId: 51453 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HjCcP01
start..stop
S start..stop
TaspCcP01 642 0 1..355 1..354
TatCcP01 628 0 1..355 1..354
TviCcP01 592 0 1..354 1..352
TharCcP01 592 0 1..355 1..354
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 443907..444381 475 N° 2 443251..443843 593  
complement(join(443251..443843,443907..444381))


exon

Literature and cross-references HjCcP01
Literature Martinez,D., Rokhsar,D., Putnam,N., Grigoriev,I., Salamov,A., Bristow,J., Rubin,E., Lucas,S., Hammon,N., Israni,S., Glavina,T., Detter,C. and Richardson,P. The Genome of Trichoderma reesei QM9414
DNA ref. JGI genome:   scaffold_12 (444381..443251)
Cluster/Prediction ref. JGI gene:   49205
Protein sequence: HjCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   356
PWM (Da):   %s   39629.67 Transmb domain:   %s   i44-66o
PI (pH):   %s   8.4
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSARQFARVATRTTTRSFAAVPRQAFRQQGRRFYSSEPEKKSSSSLLYLGAAAAAGGLGIWYFTSGASASSKEFVPTQADYQKVYNDIAERLEVDDYDDGSYGPVLVRLAWHASGTYDKETGTGGSNGATMRFAPESAHGANAGLIAARDFLEPIKAKYPWISYSDLWILGGVCAIQEMHGPIIPYRPGRRDADAAACTPDGRLPDASKGARHLRDIFYRMGFNDQEIVALSGGHAIGRCHRDRSGYDGPWTFSPTMLTNDFYKLLLEEKWQVKKWDGPKQFEDKTTKSLMMLPTDMVLVQDKAFKPWVEKYAADNELFFRDFSNVVLRLFELGVPFAEGTENNRWTFKPTHS

Retrieve as FASTA  
Remarks Complete sequence fron genomic (1 intron). Strain="QM9414".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCTCTGCCCGTCAGTTCGCCCGCGTGGCAACCCGCACAACCACCCGCTCCTTCGCCGCCGTCCCTCGACAGGCTTTCCGCCAGCAGGGCCGCCGCTTCTACTCCTCCGAGCCT
GAGAAGAAGTCCTCCTCCTCCCTCCTGTACCTTGGCGCCGCCGCCGCCGCCGGTGGCCTGGGCATCTGGTACTTCACCTCTGGCGCCTCTGCCTCCTCCAAGGAGTTTGTTCCCACCCAG
GCCGACTACCAGAAGGTGTACAACGACATCGCAGAGCGTCTCGAGGTCGACGACTATGACGATGGCAGCTACGGCCCCGTCCTGGTGCGTCTCGCCTGGCACGCCAGCGGCACCTACGAC
AAGGAGACCGGGACCGGTGGCAGCAACGGCGCCACTATGCGATTTGCTCCCGAGAGCGCTCACGGTGCCAACGCCGGTCTGATTGCTGCTCGTGACTTCCTCGAGCCTATCAAGG
GTAAG
CCTCTTGTCGTTTGTGCGCATAGAGTTAGGGACGTCAGCTAACAGCCGAAACCAATAGCCAAGTACCCCTGGATCAGCTACTCCGATCTCTGGATCCTCGGCGGCGTTTGCGCCATCCAG
GAGATGCACGGCCCCATCATCCCCTACCGACCCGGCCGCCGCGACGCCGACGCTGCCGCCTGCACCCCCGACGGCCGCCTGCCCGACGCCAGCAAGGGCGCCAGGCACCTGCGTGACATC
TTCTACCGCATGGGCTTCAACGACCAGGAGATTGTCGCCCTCAGCGGTGGCCACGCCATCGGCCGATGCCACCGCGACCGATCCGGCTACGATGGCCCCTGGACCTTCTCCCCCACCATG
CTGACCAACGACTTCTACAAGCTGCTGCTGGAGGAGAAGTGGCAGGTCAAGAAGTGGGACGGCCCCAAGCAGTTCGAGGACAAGACCACCAAGTCCCTCATGATGCTGCCCACCGACATG
GTTCTGGTCCAGGACAAGGCCTTCAAGCCCTGGGTTGAGAAGTACGCTGCCGACAACGAGCTCTTCTTCCGCGACTTCTCCAACGTCGTTCTCCGCCTGTTTGAGCTTGGTGTTCCTTTT
GCCGAGGGCACCGAGAACAACCGCTGGACCTTCAAGCCCACCCACTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCTCTGCCCGTCAGTTCGCCCGCGTGGCAACCCGCACAACCACCCGCTCCTTCGCCGCCGTCCCTCGACAGGCTTTCCGCCAGCAGGGCCGCCGCTTCTACTCCTCCGAGCCT
GAGAAGAAGTCCTCCTCCTCCCTCCTGTACCTTGGCGCCGCCGCCGCCGCCGGTGGCCTGGGCATCTGGTACTTCACCTCTGGCGCCTCTGCCTCCTCCAAGGAGTTTGTTCCCACCCAG
GCCGACTACCAGAAGGTGTACAACGACATCGCAGAGCGTCTCGAGGTCGACGACTATGACGATGGCAGCTACGGCCCCGTCCTGGTGCGTCTCGCCTGGCACGCCAGCGGCACCTACGAC
AAGGAGACCGGGACCGGTGGCAGCAACGGCGCCACTATGCGATTTGCTCCCGAGAGCGCTCACGGTGCCAACGCCGGTCTGATTGCTGCTCGTGACTTCCTCGAGCCTATCAAGG
CCAAG
TACCCCTGGATCAGCTACTCCGATCTCTGGATCCTCGGCGGCGTTTGCGCCATCCAGGAGATGCACGGCCCCATCATCCCCTACCGACCCGGCCGCCGCGACGCCGACGCTGCCGCCTGC
ACCCCCGACGGCCGCCTGCCCGACGCCAGCAAGGGCGCCAGGCACCTGCGTGACATCTTCTACCGCATGGGCTTCAACGACCAGGAGATTGTCGCCCTCAGCGGTGGCCACGCCATCGGC
CGATGCCACCGCGACCGATCCGGCTACGATGGCCCCTGGACCTTCTCCCCCACCATGCTGACCAACGACTTCTACAAGCTGCTGCTGGAGGAGAAGTGGCAGGTCAAGAAGTGGGACGGC
CCCAAGCAGTTCGAGGACAAGACCACCAAGTCCCTCATGATGCTGCCCACCGACATGGTTCTGGTCCAGGACAAGGCCTTCAAGCCCTGGGTTGAGAAGTACGCTGCCGACAACGAGCTC
TTCTTCCGCGACTTCTCCAACGTCGTTCTCCGCCTGTTTGAGCTTGGTGTTCCTTTTGCCGAGGGCACCGAGAACAACCGCTGGACCTTCAAGCCCACCCACTCTTAA

Retrieve as FASTA