Entry information : NfCcP02 (ccp1)
Entry ID 3397
Creation 2006-08-29 (Christophe Dunand)
Last sequence changes 2012-07-13 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-07-13 (Christophe Dunand)
Peroxidase information: NfCcP02 (ccp1)
Name (synonym) NfCcP02 (ccp1)
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Neosartorya
Organism Neosartorya fischeri    [TaxId: 36630 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NfCcP02
start..stop
S start..stop
AfumCcP02 691 0 12..366 12..366
AclCcP02 656 0 12..366 12..366
AwenCcP02 634 0 1..366 1..365
AteCcP02_NIH2624 632 0 12..366 12..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1630965..1631321 357 N° 2 1631393..1632136 744  
join(1630965..1631321,1631393..1632136)


exon

Literature and cross-references NfCcP02 (ccp1)
Literature Nierman,W.C. Direct Submission
Protein ref. UniProtKB:   A1CX63
DNA ref. GenBank:   NW_001509773.1 (1630965..1632136)
Protein sequence: NfCcP02 (ccp1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   366
PWM (Da):   %s   40284.16  
PI (pH):   %s   9.11
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASAARSASRAFLRSTPATSSFRPAVRAARFALPSQGFRAAARRGYASEANSGKSSSNVFLWAGLAVAGGAGAYFYLNGSDSVTSKTFVPGKEDYQKVYDAIARRLADETDYDDGSYGPVLVRLAWHASGTYDKETGTGGSNGATMRFAPESDHGANAGLKIARDFLEPIKAQFPWITYSDLWTLAGACAIQELGGPAIPWRPGRQDKDVAGCTPDGRLPDASKDQRHIRDIFYRMGFNDQEIVALIGAHALGRAHPDRSGYDGPWDFSPTVFTNEFFRLLLDEKWQNRKWNGPAQFTDKTTKTLMMLPADLALVKDKEFKKHVERYARDNDAFFKDFSDVFVKLLELGVPFTSKAEDRYVFKTSE*

Retrieve as FASTA  
Remarks Complete sequence from Genomic (1 intron). Strain="NRRL 181". Close to a DnaJ domain protein.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCGGCTGCTAGATCTGCTTCGCGCGCCTTCTTGCGCTCCACTCCTGCTACCTCCTCCTTCCGTCCTGCTGTCCGCGCCGCTCGCTTTGCTCTCCCATCTCAGGGCTTCCGCGCC
GCTGCTCGTCGTGGCTATGCCTCCGAAGCCAACTCGGGCAAGTCCTCGTCCAACGTCTTCCTCTGGGCTGGTCTCGCCGTGGCTGGTGGTGCCGGTGCATACTTCTACCTGAACGGCAGC
GACTCCGTTACCTCCAAGACCTTTGTTCCTGGTAAGGAGGACTACCAGAAGGTGTACGACGCCATTGCTCGCCGTCTCGCCGATGAGACCGACTATGACGATGGCAGCTATGGACCA
GTA
AGTCTTTTCCGCTTGTCAATGAAATACATGGGCGATGAACAGAGTGCTGACTTCCGGTGTTTTGATAGGTCCTCGTCCGTCTGGCATGGCATGCAAGTGGTACCTATGACAAGGAAACCG
GCACTGGAGGAAGCAACGGCGCTACCATGAGATTCGCCCCCGAGTCCGACCACGGTGCCAACGCTGGCCTCAAGATTGCTCGGGACTTCCTCGAGCCCATCAAGGCCCAGTTCCCTTGGA
TTACCTACTCCGATCTCTGGACTCTGGCCGGCGCCTGCGCCATCCAGGAACTGGGTGGTCCCGCCATTCCCTGGCGCCCTGGCCGTCAGGACAAGGACGTAGCCGGCTGCACCCCTGATG
GACGTCTCCCCGACGCTTCCAAGGACCAGAGGCACATCCGCGACATCTTCTACCGCATGGGATTCAACGACCAGGAGATCGTTGCTCTGATCGGTGCCCACGCTCTGGGCCGTGCTCACC
CCGACCGTTCTGGCTACGACGGCCCCTGGGACTTCAGCCCCACCGTTTTCACCAACGAGTTCTTCCGGCTGCTTCTTGATGAGAAGTGGCAGAACCGCAAGTGGAACGGCCCCGCCCAGT
TCACTGACAAGACCACCAAGACCCTGATGATGCTTCCCGCCGATCTTGCCCTAGTCAAGGACAAGGAGTTCAAGAAGCACGTCGAGCGCTATGCCAGGGACAACGACGCCTTCTTCAAGG
ATTTCTCGGACGTTTTCGTCAAGCTTCTCGAGCTTGGTGTCCCCTTTACCAGCAAGGCTGAGGACCGCTACGTCTTCAAGACCTCTGAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCGGCTGCTAGATCTGCTTCGCGCGCCTTCTTGCGCTCCACTCCTGCTACCTCCTCCTTCCGTCCTGCTGTCCGCGCCGCTCGCTTTGCTCTCCCATCTCAGGGCTTCCGCGCC
GCTGCTCGTCGTGGCTATGCCTCCGAAGCCAACTCGGGCAAGTCCTCGTCCAACGTCTTCCTCTGGGCTGGTCTCGCCGTGGCTGGTGGTGCCGGTGCATACTTCTACCTGAACGGCAGC
GACTCCGTTACCTCCAAGACCTTTGTTCCTGGTAAGGAGGACTACCAGAAGGTGTACGACGCCATTGCTCGCCGTCTCGCCGATGAGACCGACTATGACGATGGCAGCTATGGACCA
GTC
CTCGTCCGTCTGGCATGGCATGCAAGTGGTACCTATGACAAGGAAACCGGCACTGGAGGAAGCAACGGCGCTACCATGAGATTCGCCCCCGAGTCCGACCACGGTGCCAACGCTGGCCTC
AAGATTGCTCGGGACTTCCTCGAGCCCATCAAGGCCCAGTTCCCTTGGATTACCTACTCCGATCTCTGGACTCTGGCCGGCGCCTGCGCCATCCAGGAACTGGGTGGTCCCGCCATTCCC
TGGCGCCCTGGCCGTCAGGACAAGGACGTAGCCGGCTGCACCCCTGATGGACGTCTCCCCGACGCTTCCAAGGACCAGAGGCACATCCGCGACATCTTCTACCGCATGGGATTCAACGAC
CAGGAGATCGTTGCTCTGATCGGTGCCCACGCTCTGGGCCGTGCTCACCCCGACCGTTCTGGCTACGACGGCCCCTGGGACTTCAGCCCCACCGTTTTCACCAACGAGTTCTTCCGGCTG
CTTCTTGATGAGAAGTGGCAGAACCGCAAGTGGAACGGCCCCGCCCAGTTCACTGACAAGACCACCAAGACCCTGATGATGCTTCCCGCCGATCTTGCCCTAGTCAAGGACAAGGAGTTC
AAGAAGCACGTCGAGCGCTATGCCAGGGACAACGACGCCTTCTTCAAGGATTTCTCGGACGTTTTCGTCAAGCTTCTCGAGCTTGGTGTCCCCTTTACCAGCAAGGCTGAGGACCGCTAC
GTCTTCAAGACCTCTGAGTAA

Retrieve as FASTA