Entry information : UrCcP01
Entry ID 3399
Creation 2006-07-21 (Christophe Dunand)
Last sequence changes 2016-01-15 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-15 (Achraf Jemmat)
Peroxidase information: UrCcP01
Name UrCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Onygenaceae Uncinocarpus
Organism Uncinocarpus reesii    [TaxId: 33188 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value UrCcP01
start..stop
S start..stop
CposCcP02 532 0 1..270 1..270
CimCcP01 532 0 1..270 1..270
AcapCcP01_NAm1 489 2e-177 1..270 1..270
MicaCcP01 489 4e-177 1..270 1..270
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..110 110 N° 2 171..912 742  
join(1..110,171..912)


exon

Literature and cross-references UrCcP01
Literature Birren,B. et al., The Genome Sequencing Platform, The Genome Assembly Team. The Genome Sequence of Uncinocarpus reesii. unpublished.
DNA ref. GenBank:   NW_003052499.1 (136786..137697)
Cluster/Prediction ref. Genebank:   8439033
Protein sequence: UrCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   283
PWM (Da):   %s   31986.79  
PI (pH):   %s   5.69
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSKPGDFEAVRKDIIAQMKQPGYDDGSAGPVFVRLAWHSSGTYDKETDTGGSNGAGMRYEKEGGDPANAGLQFGRAFLEPVKKAHPWITYSDLWTLAGIVAIKEMGGPEIQWKPGRTDFVDDSKLPPRGRLPDATQGQDHLRRIFYRMGFNDQEIVALSGAHNLGRTHADRSGFNGPWVNNPIRFSNQYFKLLKNLEWKPTTLSNGVKQFTYVDPDVPEDEKEEPLMMLPTDMCLLSDPEFAKWVDRYADDKELFFDHFARAFAKLLELGDSARRQWKDYQHR

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). Strain="1704".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTAAGCCAGGCGATTTCGAAGCCGTCCGGAAGGACATCATTGCCCAGATGAAACAGCCAGGCTACGACGACGGCAGTGCTGGCCCCGTCTTCGTCCGTCTTGCCTGGTAAGTTCCT
TTTTGTACCCCTCCAACCACGACTTGTTTCTCACAGTCCCTTGTCCATAGGCACTCGTCCGGCACATATGACAAAGAAACCGACACCGGAGGTTCCAATGGTGCAGGTATGAGATATGAG
AAAGAAGGCGGCGACCCAGCAAACGCAGGCCTCCAATTTGGCCGAGCATTCCTCGAACCCGTGAAGAAGGCACACCCTTGGATCACATACTCCGATCTCTGGACGCTCGCCGGCATTGTG
GCGATCAAGGAGATGGGCGGCCCTGAGATCCAGTGGAAGCCCGGACGTACCGATTTCGTAGACGACTCTAAGCTCCCGCCACGCGGACGCCTGCCAGACGCGACACAAGGACAAGACCAT
CTCCGTCGCATCTTCTACCGCATGGGCTTCAACGACCAAGAGATCGTCGCTCTCTCGGGCGCACACAATCTTGGCCGCACGCACGCCGACCGTAGCGGCTTCAACGGGCCCTGGGTCAAC
AATCCCATCCGCTTCTCAAACCAGTATTTCAAACTCCTCAAGAACTTGGAATGGAAGCCGACGACGCTGTCCAACGGAGTCAAACAGTTCACATACGTCGACCCAGACGTTCCCGAGGAC
GAGAAGGAGGAGCCGCTGATGATGCTTCCGACGGATATGTGTTTGCTCTCGGATCCCGAGTTCGCCAAATGGGTGGATCGATATGCAGATGACAAGGAGCTGTTTTTCGACCATTTCGCC
CGTGCATTTGCCAAGTTGCTGGAGCTGGGGGATTCAGCGAGACGCCAGTGGAAGGATTACCAACACAGATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTAAGCCAGGCGATTTCGAAGCCGTCCGGAAGGACATCATTGCCCAGATGAAACAGCCAGGCTACGACGACGGCAGTGCTGGCCCCGTCTTCGTCCGTCTTGCCTGGCACTCGTCC
GGCACATATGACAAAGAAACCGACACCGGAGGTTCCAATGGTGCAGGTATGAGATATGAGAAAGAAGGCGGCGACCCAGCAAACGCAGGCCTCCAATTTGGCCGAGCATTCCTCGAACCC
GTGAAGAAGGCACACCCTTGGATCACATACTCCGATCTCTGGACGCTCGCCGGCATTGTGGCGATCAAGGAGATGGGCGGCCCTGAGATCCAGTGGAAGCCCGGACGTACCGATTTCGTA
GACGACTCTAAGCTCCCGCCACGCGGACGCCTGCCAGACGCGACACAAGGACAAGACCATCTCCGTCGCATCTTCTACCGCATGGGCTTCAACGACCAAGAGATCGTCGCTCTCTCGGGC
GCACACAATCTTGGCCGCACGCACGCCGACCGTAGCGGCTTCAACGGGCCCTGGGTCAACAATCCCATCCGCTTCTCAAACCAGTATTTCAAACTCCTCAAGAACTTGGAATGGAAGCCG
ACGACGCTGTCCAACGGAGTCAAACAGTTCACATACGTCGACCCAGACGTTCCCGAGGACGAGAAGGAGGAGCCGCTGATGATGCTTCCGACGGATATGTGTTTGCTCTCGGATCCCGAG
TTCGCCAAATGGGTGGATCGATATGCAGATGACAAGGAGCTGTTTTTCGACCATTTCGCCCGTGCATTTGCCAAGTTGCTGGAGCTGGGGGATTCAGCGAGACGCCAGTGGAAGGATTAC
CAACACAGATAA

Retrieve as FASTA