Entry information : AcapCcP02
Entry ID 3403
Creation 2006-08-11 (Christophe Dunand)
Last sequence changes 2012-07-16 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-07-16 (Christophe Dunand)
Peroxidase information: AcapCcP02
Name AcapCcP02
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Ajellomycetaceae Ajellomyces
Organism Ajellomyces capsulatus    [TaxId: 5037 ]
Cellular localisation Mitochondria
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcapCcP02
start..stop
S start..stop
AderCcP02 657 0 1..374 1..376
PbrCcP02 582 0 1..372 1..372
TstCcP02 575 0 1..373 1..360
CposCcP01 563 0 1..373 1..373
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1295..1672 378 N° 2 1742..1898 157 N° 3 1979..2334 356 N° 4 2408..2641 234
join(1295..1672,1742..1898,1979..2334,2408..2641)


exon

Literature and cross-references AcapCcP02
Literature Birren,B., Ma,L.J., LaButti,K., Lander,E., Taylor,J., Osguthorpe,R., Magrini,V. and Goldman,W.E. The Genome Sequence of Ajellomyces capsulatus (Histoplasma capsulatum) NAm1

DNA ref. GenBank:   AAJI01002010 [5' end]   AAJI01002811 [3' end]
Protein sequence: AcapCcP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   375
PWM (Da):   %s   41455.51  
PI (pH):   %s   9.53
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFAARTFTRAFARAPLASSSSSSIRTSGRHAGRFALPSQSFRGGSRRGYSSDPGAGKSSTGYYLGLGAVLAGGAGAFYYWNNDGLKAVAKPASFTPTKDDYQKVYDEIAKLLVEKDDYDDGSYGPVLVRLAWHASGTYDKTSGTGGSNGATMRFSPEGDHSANAGLKAARDFLEPVKAKFPWISYSDLWTLAGACAIQEMQGPKIPWRPGRLDRDVTFCTPDGRLPDASKDHRHIRDIFGRMGFDDREMVALSGAHSLGRAHPDRSGYDGPWDFSPTVFTNEFFRLLVEEKWNWKWSGPAQYTDNTTKTLMMLPTDMALVKDKEFKKHVERYAKDSDAFFREFSDAFVKLLELGVPFTSKAEDRIRFKSSHD*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST. Overlap of two contigs: AAJI01002010) and AAJI01002811. Strain="NAm1".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTGCTGCTAGAACTTTCACCAGGGCTTTTGCTCGTGCTCCCCTTGCGAGCAGCTCCTCTTCATCCATCCGAACTTCCGGTCGTCATGCAGGCCGTTTTGCCCTTCCCTCCCAA
AGCTTCCGAGGTGGATCCCGCAGGGGGTATTCCTCTGATCCTGGAGCAGGAAAGTCTTCTACTGGCTATTATCTTGGATTGGGTGCTGTTCTAGCTGGAGGTGCTGGTGCCTTCTACTAC
TGGAATAACGATGGACTGAAAGCTGTTGCCAAACCAGCGTCTTTCACTCCAACCAAGGACGATTACCAGAAGGTGTACGATGAAATTGCGAAGCTCTTGGTAGAAAAAGACGACTATGAT
GACGGAAGCTATGGACCG
GTGAGCTAAACTTCGTCTCAGCCTTCATTCCTAGTAGCATTTTATAATTTATGGTTTGTTTTTGAGCAGGTTCTTGTCCGATTGGCATGGCACGCGAGCGGC
ACCTATGATAAGACAAGTGGCACTGGGGGAAGCAATGGCGCCACTATGCGCTTCTCTCCCGAAGGCGACCATTCGGCGAACGCTGGCTTGAAAGCTGCTAGGGATTTCCTCGAGCCAGTC
AAGG
GTAAGGAACATAAAATAAAAGGCCCTTTCATAACATTCATAAAGTTTCGTAGCGATTCACCTCGCTAACCTACATGTTAGCTAAATTCCCTTGGATCTCCTACTCCGATCTTTGGA
CTCTTGCTGGTGCTTGCGCCATTCAGGAAATGCAAGGGCCGAAGATTCCGTGGCGCCCAGGCCGCTTAGACAGGGATGTAACCTTCTGCACACCTGACGGACGTCTTCCTGATGCTTCCA
AAGACCATAGACATATCAGAGATATCTTTGGACGCATGGGTTTTGACGATCGTGAGATGGTCGCCCTCAGCGGCGCTCACTCCCTTGGTCGTGCCCATCCTGACCGGTCTGGTTATGACG
GTCCTTGGGACTTCAGTCCGACTGTCTTCACCAACGAATTCTTCAGATTGCTGGTTGAGGAGAAATGGAACTGGAAGAAG
GTAATCAAAAATGCAAATATATATTCGGTCAAATAGCTGT
TCGATTCATGAACTGACTAAACCAAAATTCCAGTGGAGCGGTCCTGCCCAATACACCGACAATACCACTAAAACTCTGATGATGCTTCCTACCGATATGGCTCTTGTAAAAGACAAGGAG
TTCAAGAAGCACGTCGAACGATATGCCAAGGACAGCGACGCATTCTTCAGGGAATTCTCGGATGCGTTCGTCAAGCTCCTCGAGCTTGGCGTTCCCTTCACCTCCAAGGCTGAAGATCGC
ATACGATTCAAGTCTTCCCACGACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTGCTGCTAGAACTTTCACCAGGGCTTTTGCTCGTGCTCCCCTTGCGAGCAGCTCCTCTTCATCCATCCGAACTTCCGGTCGTCATGCAGGCCGTTTTGCCCTTCCCTCCCAA
AGCTTCCGAGGTGGATCCCGCAGGGGGTATTCCTCTGATCCTGGAGCAGGAAAGTCTTCTACTGGCTATTATCTTGGATTGGGTGCTGTTCTAGCTGGAGGTGCTGGTGCCTTCTACTAC
TGGAATAACGATGGACTGAAAGCTGTTGCCAAACCAGCGTCTTTCACTCCAACCAAGGACGATTACCAGAAGGTGTACGATGAAATTGCGAAGCTCTTGGTAGAAAAAGACGACTATGAT
GACGGAAGCTATGGACCG
GTTCTTGTCCGATTGGCATGGCACGCGAGCGGCACCTATGATAAGACAAGTGGCACTGGGGGAAGCAATGGCGCCACTATGCGCTTCTCTCCCGAAGGCGAC
CATTCGGCGAACGCTGGCTTGAAAGCTGCTAGGGATTTCCTCGAGCCAGTCAAGG
CTAAATTCCCTTGGATCTCCTACTCCGATCTTTGGACTCTTGCTGGTGCTTGCGCCATTCAGGAA
ATGCAAGGGCCGAAGATTCCGTGGCGCCCAGGCCGCTTAGACAGGGATGTAACCTTCTGCACACCTGACGGACGTCTTCCTGATGCTTCCAAAGACCATAGACATATCAGAGATATCTTT
GGACGCATGGGTTTTGACGATCGTGAGATGGTCGCCCTCAGCGGCGCTCACTCCCTTGGTCGTGCCCATCCTGACCGGTCTGGTTATGACGGTCCTTGGGACTTCAGTCCGACTGTCTTC
ACCAACGAATTCTTCAGATTGCTGGTTGAGGAGAAATGGAACTGGAAGAAG
TGGAGCGGTCCTGCCCAATACACCGACAATACCACTAAAACTCTGATGATGCTTCCTACCGATATGGCT
CTTGTAAAAGACAAGGAGTTCAAGAAGCACGTCGAACGATATGCCAAGGACAGCGACGCATTCTTCAGGGAATTCTCGGATGCGTTCGTCAAGCTCCTCGAGCTTGGCGTTCCCTTCACC
TCCAAGGCTGAAGATCGCATACGATTCAAGTCTTCCCACGACTGA

Retrieve as FASTA