Entry information : CnCcP02_R265
Entry ID 3410
Creation 2006-07-25 (Christophe Dunand)
Last sequence changes 2012-05-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-22 (Christophe Dunand)
Peroxidase information: CnCcP02_R265
Name CnCcP02_R265
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Basidiomycota Tremellomycetes Tremellaceae Filobasidiella
Organism Cryptococcus neoformans (Filobasidiella neoformans)    [TaxId: 5207 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CnCcP02_R265
start..stop
S start..stop
CnCcP02_grubiiH99 664 0 1..334 1..334
CnCcP02_JEC21 663 0 1..334 1..334
CgaCcP02 619 0 1..334 1..341
DcryCcP02 519 0 1..312 1..310
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 78052..78082 31 N° 2 77920..77995 76 N° 3 77827..77866 40 N° 4 77745..77764 20
N° 5 77654..77678 25 N° 6 77496..77592 97 N° 7 77210..77434 225 N° 8 77125..77158 34
N° 9 76980..77075 96 N° 10 76877..76925 49 N° 11 76712..76817 106 N° 12 76444..76649 206
complement(join(76444..76649,76712..76817,76877..76925,76980..77075,77125..77158 ,77210..77434,77496..77592,77654..77678,77745..77764,77827..77866,77920..77995,7 8052..78082))


exon

Literature and cross-references CnCcP02_R265
Literature Lander,E., Birren,B., The Genome Sequencing Platform, The Genome Assembly Team and Ma,L. The Genome Sequence of Cryptococcus
DNA ref. GenBank:   AAFP01000552.1 (78082..76444)
Protein sequence: CnCcP02_R265
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334
PWM (Da):   %s   35872.76  
PI (pH):   %s   6.04
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASVKEGDYQALKEEIKKIMKQPAYDDGSAGPVLVRLAWHASGNFSLVHNGGSNGAGMRFPPSVDPANAGLHHAISFLLPLQSANPWISHADLWTLAGVTAVEAMGGPQIPWEPGRGDYESEQAAADHRGDVSNRLPDGALGAAHIRDVFGRMGFSDQEIVALSGAHNLGRCHADRSGFDGPWVVNPTRFSNQYFKLLLRPIWKPRQWDGPFQYEAIVAGTRLMMLPTMALIEDPAFRPWVEKYAADQNLFFKDFANAFGKLIELGVDRDDTGFARLTRKAAQEGKPLDKTAPPAGDGTCPVSGAVGGGVQRAGGGGGCPFMAMQNREAKL

Retrieve as FASTA  
Remarks Complete sequence from genomic ( 11 exons predicted with Softberry). Strain="R265".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCAGTGAAAGAAGGAGACTACCAAGGTAAGATAAAGAGCCTATGATGAGGGAAGAATCTTGACCGACTTTCTGCGAATCAGCTCTGAAGGAGGAGATCAAGAAGATTATGAAGC
AGCCTGCGTATGACGATGGATCTGCTGGTCCCGTTTTGGTCAG
GTATGCCAGAATCGCATGAATCACAGTCTTTATATGCTTATCAGTAATGACAGACTGGCTTGGCATGCCTCTGGAAA
CTTCAGTCTTGTGGAA
GTAAGCTCACTCATTGCTGGTCAACCTTATGTTAAAAATCTCAGCTAACATGCCGTTTATAGCACAACGGAGGTTCTAACGGGTAAGCAAGCATTTTCAAGCGT
ACATTTCAGCTCTTTACCTTTTCAAGCTAATTTATGGAGCTAAGAGCTGGAATGAGATTTCCACCAGAAGTGAGTTTCAATGAATCTTCTTTGCTTCACGCGTAAAGACAAGGCTAAACC
AATTTTTCAGTCTGTTGACCCCGCCAATGCCGGTCTTCATCATGCCATATCATTCCTTCTTCCACTTCAAAGTGCCAATCCCTGGATCTCTCACGCAGACTTGTGGAGTATGTTCTTCTT
TCATTCCCAACTGCCACGGCTTCCATTAATTGACTGTTATTTTTTAAGCTCTGGCAGGAGTAACAGCTGTCGAGGCAATGGGCGGTCCGCAAATCCCCTGGGAACCCGGAAGAGGAGATT
ATGAATCTGAACAAGCCGCAGCAGACCATCGAGGTGATGTGTCCAACCGTTTACCGGATGGAGCTTTGGGCGCAGCCCACATTAGGGACGTGTTTGGGAGAATGGGGTTCTCAGACCAAG
AAATTGTAGCGCTCAGCGGGGCTCATAATCTCG
GTGAGTGGTGCGAGGTAGAAACATGCTTTTAATACTAATTCGGCTCGTTAGGGCGCTGCCATGCGGACCGAAGTGGTTTTGATGGGT
ACGGAAAGATAGGCTCCCAACGTGACGTTGACTGATAAGCTATGCAGACCATGGGTGGTCAATCCTACCCGCTTCTCCAACCAATATTTCAAACTTCTCCTTCGTCCCATTTGGAAACCC
CGGCAGTGGGATGGACCATTCCA
GTAGGTATATTTACACATCACTCCTTATAATCTGCACTGACATGAAGATTGTAGATATGAAGCTATTGTGGCCGGCACAAGGCTTATGATGCTCCCA
ACAGAC
GTAAATTCACTTTCCATTTTTTTGGCATCTGCGCAACAGCTTATTGACTCCTGTCATAGATGGCTCTCATTGAAGATCCAGCATTCCGTCCATGGGTCGAAAAATACGCCGCAG
ACCAAAATCTCTTCTTCAAAGATTTCGCCAATGCATTTGGTAAATTAATAG
GTATGCCTTCATCTTGATGCCCCTTCAGCCTCCCATTGCTGATTTTCTCAACAATCATTTAGAGCTGGG
AGTAGATAGGGATGACACAGGCTTTGCTCGACTGACCAGAAAGGCTGCTCAGGAGGGCAAGCCATTGGACAAGACTGCTCCTCCGGCCGGCGACGGAACTTGTCCCGTCTCTGGAGCAGT
AGGCGGTGGAGTTCAAAGAGCTGGTGGTGGTGGTGGTTGTCCTTTCATGGCCATGCAGAACAGGGAGGCAAAGTTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCAGTGAAAGAAGGAGACTACCAAGCTCTGAAGGAGGAGATCAAGAAGATTATGAAGCAGCCTGCGTATGACGATGGATCTGCTGGTCCCGTTTTGGTCAGACTGGCTTGGCAT
GCCTCTGGAAACTTCAGTCTTGTGGAA
CACAACGGAGGTTCTAACGGAGCTGGAATGAGATTTCCACCAGAATCTGTTGACCCCGCCAATGCCGGTCTTCATCATGCCATATCATTCCTT
CTTCCACTTCAAAGTGCCAATCCCTGGATCTCTCACGCAGACTTGTGGA
CTCTGGCAGGAGTAACAGCTGTCGAGGCAATGGGCGGTCCGCAAATCCCCTGGGAACCCGGAAGAGGAGAT
TATGAATCTGAACAAGCCGCAGCAGACCATCGAGGTGATGTGTCCAACCGTTTACCGGATGGAGCTTTGGGCGCAGCCCACATTAGGGACGTGTTTGGGAGAATGGGGTTCTCAGACCAA
GAAATTGTAGCGCTCAGCGGGGCTCATAATCTCG
GGCGCTGCCATGCGGACCGAAGTGGTTTTGATGGACCATGGGTGGTCAATCCTACCCGCTTCTCCAACCAATATTTCAAACTTCTC
CTTCGTCCCATTTGGAAACCCCGGCAGTGGGATGGACCATTCCA
ATATGAAGCTATTGTGGCCGGCACAAGGCTTATGATGCTCCCAACAGACATGGCTCTCATTGAAGATCCAGCATTC
CGTCCATGGGTCGAAAAATACGCCGCAGACCAAAATCTCTTCTTCAAAGATTTCGCCAATGCATTTGGTAAATTAATAG
AGCTGGGAGTAGATAGGGATGACACAGGCTTTGCTCGACTG
ACCAGAAAGGCTGCTCAGGAGGGCAAGCCATTGGACAAGACTGCTCCTCCGGCCGGCGACGGAACTTGTCCCGTCTCTGGAGCAGTAGGCGGTGGAGTTCAAAGAGCTGGTGGTGGTGGT
GGTTGTCCTTTCATGGCCATGCAGAACAGGGAGGCAAAGTTGTAA

Retrieve as FASTA