Entry information : GmoCP01 (GmoKatG1)
Entry ID 3415
Creation 2007-07-12 (Christophe Dunand)
Last sequence changes 2011-05-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-05-11 (Christophe Dunand)
Peroxidase information: GmoCP01 (GmoKatG1)
Name (synonym) GmoCP01 (GmoKatG1)
Class Catalase peroxidase    [Orthogroup: CP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Nectriaceae Gibberella
Organism Gibberella moniliformis (Fusarium verticillioides)    [TaxId: 117187 ]
Cellular localisation Cytosolic
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmoCP01
start..stop
S start..stop
FoCP01 1598 0 1..800 1..801
GzCP01 1417 0 1..800 1..801
NhaeCP01 1281 0 43..800 3..760
TatCP01 1137 0 40..800 1..761
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 156796..157248 453 N° 2 157319..157715 397 N° 3 157771..159323 1553  
join(156796..157248,157319..157715,157771..159323)


exon

Literature and cross-references GmoCP01 (GmoKatG1)
Literature REFERENCE 1 Zamocky, M., Furtmüller, P.G. and Obinger, C. Two distinct groups of fungal catalase/peroxidases. (2009) Bioch. Soc. Trans. 37: 772-777
REFERENCE 2 Birren,B., Ma,L. and Lander,E.The Genome Assembly Team. The Genome Sequence of Gibberella moniliformis (Fusarium verticillioides) 7600.
REFERENCE 3 Zamocky M., Jakopitsch C., Vlasits J., and Obinger C. Fungal catalase-peroxidases - a novel group of bifunctional oxidoreductases.(2007) J. Biol. Inorg. Chem. 12:S97
Protein ref. UniProtKB:   C0P9M3 (40..)
DNA ref. GenBank:   AAIM02000135 (156796..159323)
Cluster/Prediction ref. UniGene:   Gmo.4299
Protein sequence: GmoCP01 (GmoKatG1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   800
PWM (Da):   %s   88388.46  
PI (pH):   %s   6.98
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPRFLFPSSRILSLSVARRTLNLNQQQHFRLSLHTSASKMADERKCPVAHKVPNVAGHGVTHQKWWPEALKTNILRQHSAVTNPYGENFNYAEAFNSIDYNELKEDLRKVCRDSQDWWPADFGHYGGLFVRMSWHAVGTYRVFDGRGGGRQGQQRFAPLNSWPDNVSLDKARRLLWPVKQKYGNKVSWADLIVMAGNVALEDMGFKTIGFAAGRPDTWEADEATYYGGEDTWLGNDVRYSDGHPGTTKPGATDSDQAPHKNIHTRELEKPLAAAHHGLIYVNPEGPDGNPDPVAAARDIRETFGRMAMNDEETVALIAGGHTVGKTHGAGSTDHVGPEPEAADLAQQGLGWSNSYKTGKGPHTTTSGLEVTWTSTPVKWSHDYLKYLFQFEWELTKSPAGAHQWVAKDANATVPDAFDPNKKQKPTMLTTDLSLRFDPEYEKISRRFLENPDEFNEVFAKAWFKLTHRDMGPRDRYLGPEVPKEVFLWQDPVPERDYKLVDDGDISAIKNEILKSGVDVSKLVSTAWASASTFRGSDLRGGANGARIRLQPQKDWEVNNPAQLSKVLSTLEGIQKKFNDSQSSGKAISLADVIVLAGSAAVEKAAKDAGVNITVPFAPGRTDATQEQTDVKSVNHLQPFADGFRNYGSSTDRVKLEHQLIDRAQLLTLSVPELTALIGGLRALNTNYDGSSHGIFTNRPGVLTNDFFVNLLDMSTEWKAIGNGDIFEGTDRKTGAKKWTGTRVDLVFGSHAELRATAETYAEAGGQEKLVKDFVAAWTKVMNLDRFDLAKGSSPKASPRL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 11, 2 introns) and ESTs. Strain="7600". Prediction: non-secretory protein.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTCGGTTTCTGTTCCCTTCCTCTCGTATTCTGTCCTTGTCTGTAGCGAGGAGGACTCTGAATCTGAACCAACAACAACACTTCAGGTTATCGCTTCATACTTCAGCTTCCAAAATG
GCCGACGAGAGAAAGTGTCCCGTCGCCCATAAGGTCCCCAACGTCGCTGGTCACGGCGTTACCCACCAGAAGTGGTGGCCCGAGGCCCTCAAGACCAACATCCTCCGTCAGCACAGCGCC
GTTACCAACCCCTACGGCGAGAACTTCAACTACGCCGAGGCCTTCAACTCTATTGACTACAACGAGCTCAAGGAGGATCTGCGAAAGGTCTGCCGCGACTCGCAGGACTGGTGGCCTGCT
GATTTCGGTCACTATGGTGGTCTCTTTGTCCGTATGTCGTGGCACGCCGTTGGAACATACCGTGTCTTTGATGGCCGAGGTGGCGGCCGACAG
GTAAGAAATCCATCCATTACACCCTCT
CGCTCTCTCTTATCAATCGCGCACAAGTCTAACAGCGTCATAGGGTCAGCAAAGATTCGCCCCCCTCAACTCTTGGCCCGATAACGTTTCCCTCGACAAGGCCCGCCGCCTTCTCTGGCC
CGTCAAGCAAAAGTACGGCAACAAGGTCTCATGGGCCGATCTGATCGTCATGGCTGGCAACGTTGCCCTCGAGGATATGGGCTTCAAGACCATTGGCTTCGCCGCTGGTCGTCCCGATAC
TTGGGAGGCTGACGAGGCTACCTACTACGGTGGCGAGGATACCTGGCTCGGAAACGATGTCCGTTACTCTGATGGCCACCCCGGAACCACCAAGCCCGGCGCTACCGATTCCGATCAGGC
TCCCCACAAGAACATTCACACCCGCGAGCTTGAGAAGCCTTTGGCTGCTGCTCACCACGGTCTTATTTATGTCAACCCTG
GTTAGTACTCCCAAAGCCAATAATACGTAATGCGCGTACA
CTAACTTTATCACAGAGGGTCCTGATGGCAACCCCGATCCCGTCGCCGCTGCGCGCGACATCCGCGAGACCTTCGGTCGCATGGCCATGAACGACGAGGAGACCGTCGCCCTCATCGCCG
GTGGTCACACCGTCGGAAAGACCCACGGCGCTGGCTCAACCGACCACGTCGGCCCCGAGCCCGAGGCCGCTGACCTCGCCCAGCAGGGTCTCGGCTGGTCCAACAGCTACAAGACCGGCA
AGGGTCCTCACACAACCACCTCCGGTCTCGAGGTTACCTGGACCAGCACTCCCGTCAAGTGGAGCCACGACTACCTCAAGTACCTCTTCCAGTTCGAGTGGGAGCTCACAAAGAGCCCTG
CTGGCGCTCACCAGTGGGTTGCCAAGGATGCCAACGCCACTGTCCCTGATGCCTTCGATCCCAACAAGAAGCAGAAGCCTACCATGTTGACTACCGATTTATCTCTGCGCTTCGACCCTG
AGTACGAGAAGATCTCTCGTCGCTTCCTCGAGAACCCAGACGAGTTCAACGAGGTTTTCGCCAAGGCCTGGTTCAAACTTACCCACCGTGACATGGGTCCCCGCGACCGATACCTCGGCC
CTGAGGTCCCCAAGGAGGTCTTCCTCTGGCAGGACCCCGTCCCCGAGCGTGACTACAAGCTCGTCGATGACGGCGACATCTCCGCCATCAAGAACGAGATCCTCAAGTCTGGTGTCGACG
TTTCCAAGCTCGTCTCTACCGCTTGGGCCTCCGCCTCCACCTTCCGAGGCAGTGATCTCCGCGGCGGTGCCAATGGCGCCCGTATCCGCCTCCAGCCCCAGAAGGACTGGGAGGTCAACA
ACCCCGCTCAATTGAGCAAGGTCCTCAGCACTCTTGAAGGCATCCAGAAGAAGTTCAACGACTCTCAGTCCAGCGGCAAGGCCATCTCCCTTGCCGATGTTATTGTTCTTGCTGGTTCCG
CCGCTGTTGAGAAGGCTGCTAAGGATGCCGGTGTTAACATCACCGTGCCCTTCGCGCCCGGCCGCACCGACGCTACACAGGAGCAGACCGACGTCAAGTCGGTCAACCACCTCCAGCCCT
TCGCCGATGGTTTCCGTAACTACGGCTCTTCTACAGACCGTGTCAAGCTTGAGCACCAGCTCATTGACCGTGCTCAACTCCTCACCCTCAGCGTCCCTGAGCTTACCGCTCTCATCGGTG
GTCTCCGTGCCCTCAACACCAACTATGACGGCTCATCGCACGGTATCTTCACCAACCGTCCTGGTGTCCTGACCAACGACTTCTTCGTCAACCTGCTCGACATGAGCACTGAGTGGAAGG
CCATTGGAAACGGTGACATCTTCGAGGGTACTGATCGCAAGACCGGTGCCAAGAAGTGGACCGGTACCCGTGTCGATCTCGTCTTCGGATCACACGCCGAGCTCCGCGCTACAGCTGAGA
CATATGCTGAGGCCGGTGGACAAGAGAAGCTTGTCAAGGACTTTGTTGCTGCTTGGACCAAGGTGATGAACCTGGACCGATTTGATCTTGCCAAGGGTTCTTCGCCCAAGGCCTCTCCTC
GACTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTCGGTTTCTGTTCCCTTCCTCTCGTATTCTGTCCTTGTCTGTAGCGAGGAGGACTCTGAATCTGAACCAACAACAACACTTCAGGTTATCGCTTCATACTTCAGCTTCCAAAATG
GCCGACGAGAGAAAGTGTCCCGTCGCCCATAAGGTCCCCAACGTCGCTGGTCACGGCGTTACCCACCAGAAGTGGTGGCCCGAGGCCCTCAAGACCAACATCCTCCGTCAGCACAGCGCC
GTTACCAACCCCTACGGCGAGAACTTCAACTACGCCGAGGCCTTCAACTCTATTGACTACAACGAGCTCAAGGAGGATCTGCGAAAGGTCTGCCGCGACTCGCAGGACTGGTGGCCTGCT
GATTTCGGTCACTATGGTGGTCTCTTTGTCCGTATGTCGTGGCACGCCGTTGGAACATACCGTGTCTTTGATGGCCGAGGTGGCGGCCGACAG
GGTCAGCAAAGATTCGCCCCCCTCAAC
TCTTGGCCCGATAACGTTTCCCTCGACAAGGCCCGCCGCCTTCTCTGGCCCGTCAAGCAAAAGTACGGCAACAAGGTCTCATGGGCCGATCTGATCGTCATGGCTGGCAACGTTGCCCTC
GAGGATATGGGCTTCAAGACCATTGGCTTCGCCGCTGGTCGTCCCGATACTTGGGAGGCTGACGAGGCTACCTACTACGGTGGCGAGGATACCTGGCTCGGAAACGATGTCCGTTACTCT
GATGGCCACCCCGGAACCACCAAGCCCGGCGCTACCGATTCCGATCAGGCTCCCCACAAGAACATTCACACCCGCGAGCTTGAGAAGCCTTTGGCTGCTGCTCACCACGGTCTTATTTAT
GTCAACCCTG
AGGGTCCTGATGGCAACCCCGATCCCGTCGCCGCTGCGCGCGACATCCGCGAGACCTTCGGTCGCATGGCCATGAACGACGAGGAGACCGTCGCCCTCATCGCCGGTGGT
CACACCGTCGGAAAGACCCACGGCGCTGGCTCAACCGACCACGTCGGCCCCGAGCCCGAGGCCGCTGACCTCGCCCAGCAGGGTCTCGGCTGGTCCAACAGCTACAAGACCGGCAAGGGT
CCTCACACAACCACCTCCGGTCTCGAGGTTACCTGGACCAGCACTCCCGTCAAGTGGAGCCACGACTACCTCAAGTACCTCTTCCAGTTCGAGTGGGAGCTCACAAAGAGCCCTGCTGGC
GCTCACCAGTGGGTTGCCAAGGATGCCAACGCCACTGTCCCTGATGCCTTCGATCCCAACAAGAAGCAGAAGCCTACCATGTTGACTACCGATTTATCTCTGCGCTTCGACCCTGAGTAC
GAGAAGATCTCTCGTCGCTTCCTCGAGAACCCAGACGAGTTCAACGAGGTTTTCGCCAAGGCCTGGTTCAAACTTACCCACCGTGACATGGGTCCCCGCGACCGATACCTCGGCCCTGAG
GTCCCCAAGGAGGTCTTCCTCTGGCAGGACCCCGTCCCCGAGCGTGACTACAAGCTCGTCGATGACGGCGACATCTCCGCCATCAAGAACGAGATCCTCAAGTCTGGTGTCGACGTTTCC
AAGCTCGTCTCTACCGCTTGGGCCTCCGCCTCCACCTTCCGAGGCAGTGATCTCCGCGGCGGTGCCAATGGCGCCCGTATCCGCCTCCAGCCCCAGAAGGACTGGGAGGTCAACAACCCC
GCTCAATTGAGCAAGGTCCTCAGCACTCTTGAAGGCATCCAGAAGAAGTTCAACGACTCTCAGTCCAGCGGCAAGGCCATCTCCCTTGCCGATGTTATTGTTCTTGCTGGTTCCGCCGCT
GTTGAGAAGGCTGCTAAGGATGCCGGTGTTAACATCACCGTGCCCTTCGCGCCCGGCCGCACCGACGCTACACAGGAGCAGACCGACGTCAAGTCGGTCAACCACCTCCAGCCCTTCGCC
GATGGTTTCCGTAACTACGGCTCTTCTACAGACCGTGTCAAGCTTGAGCACCAGCTCATTGACCGTGCTCAACTCCTCACCCTCAGCGTCCCTGAGCTTACCGCTCTCATCGGTGGTCTC
CGTGCCCTCAACACCAACTATGACGGCTCATCGCACGGTATCTTCACCAACCGTCCTGGTGTCCTGACCAACGACTTCTTCGTCAACCTGCTCGACATGAGCACTGAGTGGAAGGCCATT
GGAAACGGTGACATCTTCGAGGGTACTGATCGCAAGACCGGTGCCAAGAAGTGGACCGGTACCCGTGTCGATCTCGTCTTCGGATCACACGCCGAGCTCCGCGCTACAGCTGAGACATAT
GCTGAGGCCGGTGGACAAGAGAAGCTTGTCAAGGACTTTGTTGCTGCTTGGACCAAGGTGATGAACCTGGACCGATTTGATCTTGCCAAGGGTTCTTCGCCCAAGGCCTCTCCTCGACTG
TAA

Retrieve as FASTA