Entry information : PpaPrx13 (Prx34a / Prx34b / PP00219G00030)
Entry ID 3419
Creation 2006-07-26 (Christophe Dunand)
Last sequence changes 2012-01-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-25 (Qiang Li)
Peroxidase information: PpaPrx13 (Prx34a / Prx34b / PP00219G00030)
Name (synonym) PpaPrx13 (Prx34a / Prx34b / PP00219G00030)
Class Class III peroxidase    [Orthogroup: Prx051]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducers Elicitor treatment (glucan, oligosaccharides, yeast extract, Phytophthora crude extract)
Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx13
start..stop
S start..stop
PpaPrx53 692 0 1..336 1..336
PpaPrx43 585 0 1..336 1..335
PpaPrx[P]13 482 2e-173 1..336 1..308
PpaPrx07 337 8e-116 12..335 8..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 45619..45870 252 N° 2 46068..46253 186 N° 3 46416..46988 573  
join(45619..45870,46068..46253,46416..46988)


exon

Literature and cross-references PpaPrx13 (Prx34a / Prx34b / PP00219G00030)
Literature REFERENCE 1 Fujita,T., Nishiyama,T., Shin-i,T., Kohara,Y. and Hasebe,M. Physcomitrella patens EST at a stage of the first asymmetric cell division of protoplasts.
REFERENCE 2 Lehtonen MT, Akita M, Kalkkinen N, et al. Quickly-released peroxidase of moss in defense against fungal invaders. NEW PHYTOLOGIST, 183, (2), 432-443
DNA ref. Phytozome 12:   scaffold_219 (45619..46988)
Cluster/Prediction ref. UniGene:   Ppa.7622
Protein sequence: PpaPrx13 (Prx34a / Prx34b / PP00219G00030)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (304)
PWM (Da):   %s   35733.8 (32378.1)  
PI (pH):   %s   6.26 (7.24) Peptide Signal:   %s   cut: 33 range:33-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAFDPMGASKLQVLLMTVAVAMFFLSGEVEANSYNLRPNYYSGKCGKYDVESIIYNEIAKAFQQDNGVAPGLVRMAFHDCFVRGCDASLLLDIPNSEKTATINLGLRASAFNAIDAAKTAVESVCPGVVSCADVLQYATRDSVLLTKGKGWTVYGGRRDGTVSNAADPPNNLPVPTMTPTQMIPLFAGKGLSADDLVALSGSHTIGIAHCIFVNPRIYGNNTDPTIPADFLASLKSQCPADSVTTNPPVGAPINLDRVSPTKFDSQYFQNIIDRKGLLTSDQSLLDDSRTRGAVYKNSGNFFNSEFGRAMQAMAGIGVLTGNEGQIRTNCRAVNP*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2) and 12 ESTs. Inverse tandem duplication or assembly error. Incorrect prediction from Phytozome (PS is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTTTCGATCCGATGGGTGCATCAAAACTGCAAGTTTTGCTGATGACAGTGGCTGTTGCCATGTTTTTCTTGAGCGGCGAGGTGGAAGCTAATTCGTACAACCTTCGACCAAAT
TATTACTCGGGCAAGTGCGGCAAATATGATGTAGAATCGATAATCTACAATGAGATTGCCAAGGCATTTCAACAGGACAATGGAGTCGCCCCCGGCCTTGTGAGGATGGCCTTCCATGAT
TGTTTCGTTCGT
GTAAGTGTGGACTCTCCTTCGTCGTGCGACTTCGTCCAGTGCTTGTAATTTGTGTAGGCTTCGCCAATGTGCTTGCGTCTTGGCGAGTTTACGGGCACACGTTTTGAG
GATCAAGTCATGTCTGTGATGGTGTGCTTTTGCACCGAAATTACTTCGGACTGTGAGGATGCATCTGAAGTTGGATGTTGCTCTTCCAGGGCTGTGACGCCTCATTGCTGCTTGACATAC
CCAATTCTGAGAAGACTGCAACCATCAACCTAGGTCTTCGGGCGAGCGCTTTCAACGCAATCGACGCTGCCAAAACCGCCGTGGAGAGTGTGTGTCCAGGGGTCGTTTCCTGTGCTGACG
TTCTACAATACGCTACTCGCGACTCTGTGCTGCTG
GTGCTGCTCACTTGACCCTGAATCGATTATGTCACCACTGATTGATCATCTGTGGACAACATCTCTGTATCTTTAGTTCATGCTT
CCTTGGAAAGATTTCCCTTGAATCTCAGAACTTCCAGACGACCTCTCATGTTGAAGTCATTTGTATGTTGATTGCAGACCAAAGGTAAAGGCTGGACTGTGTATGGCGGTCGAAGAGACG
GAACTGTGTCCAACGCTGCCGACCCCCCCAACAACCTACCAGTGCCAACGATGACGCCAACTCAGATGATTCCTCTCTTCGCAGGCAAGGGATTGAGCGCCGATGATTTGGTGGCTTTGT
CGGGCAGTCACACCATCGGAATTGCTCACTGCATTTTCGTGAACCCTCGCATCTACGGGAACAACACCGATCCTACGATTCCAGCCGACTTCTTGGCGTCGTTGAAGAGTCAGTGCCCAG
CGGATTCTGTCACTACTAACCCGCCCGTTGGAGCCCCGATCAACCTGGACCGGGTTTCACCTACCAAGTTCGACTCGCAGTATTTCCAGAACATTATCGACAGGAAGGGCTTGCTCACAT
CCGACCAAAGCCTGCTGGACGATTCCAGAACCAGAGGAGCCGTGTACAAGAACAGCGGAAATTTCTTCAATTCGGAATTCGGAAGGGCCATGCAAGCCATGGCTGGAATCGGTGTACTCA
CTGGCAATGAAGGCCAAATCCGCACGAATTGTCGCGCCGTTAACCCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTTTCGATCCGATGGGTGCATCAAAACTGCAAGTTTTGCTGATGACAGTGGCTGTTGCCATGTTTTTCTTGAGCGGCGAGGTGGAAGCTAATTCGTACAACCTTCGACCAAAT
TATTACTCGGGCAAGTGCGGCAAATATGATGTAGAATCGATAATCTACAATGAGATTGCCAAGGCATTTCAACAGGACAATGGAGTCGCCCCCGGCCTTGTGAGGATGGCCTTCCATGAT
TGTTTCGTTCGT
GGCTGTGACGCCTCATTGCTGCTTGACATACCCAATTCTGAGAAGACTGCAACCATCAACCTAGGTCTTCGGGCGAGCGCTTTCAACGCAATCGACGCTGCCAAAACC
GCCGTGGAGAGTGTGTGTCCAGGGGTCGTTTCCTGTGCTGACGTTCTACAATACGCTACTCGCGACTCTGTGCTGCTG
ACCAAAGGTAAAGGCTGGACTGTGTATGGCGGTCGAAGAGAC
GGAACTGTGTCCAACGCTGCCGACCCCCCCAACAACCTACCAGTGCCAACGATGACGCCAACTCAGATGATTCCTCTCTTCGCAGGCAAGGGATTGAGCGCCGATGATTTGGTGGCTTTG
TCGGGCAGTCACACCATCGGAATTGCTCACTGCATTTTCGTGAACCCTCGCATCTACGGGAACAACACCGATCCTACGATTCCAGCCGACTTCTTGGCGTCGTTGAAGAGTCAGTGCCCA
GCGGATTCTGTCACTACTAACCCGCCCGTTGGAGCCCCGATCAACCTGGACCGGGTTTCACCTACCAAGTTCGACTCGCAGTATTTCCAGAACATTATCGACAGGAAGGGCTTGCTCACA
TCCGACCAAAGCCTGCTGGACGATTCCAGAACCAGAGGAGCCGTGTACAAGAACAGCGGAAATTTCTTCAATTCGGAATTCGGAAGGGCCATGCAAGCCATGGCTGGAATCGGTGTACTC
ACTGGCAATGAAGGCCAAATCCGCACGAATTGTCGCGCCGTTAACCCTTAG

Retrieve as FASTA