Entry information : PpaPrx14
Entry ID 3420
Creation 2009-08-17 (Christophe Dunand)
Last sequence changes 2011-01-25 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: PpaPrx14
Name PpaPrx14
Class Class III peroxidase    [Orthogroup: Prx051]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx14
start..stop
S start..stop
PpaPrx29 350 7e-121 30..336 18..321
PpaPrx51 338 2e-116 33..337 21..320
PpaPrx55 335 3e-115 33..337 21..320
PpaPrx31 309 8e-105 39..337 28..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 110911..111177 267 N° 2 110543..110722 180 N° 3 110260..110428 169 N° 4 109752..110152 401
complement(join(109752..110152,110260..110428,110543..110722,110911..111177))


exon

Literature and cross-references PpaPrx14
Literature Nishiyama,T., Fujita,T., Shin-i,T., Seki,M., Nishide,H., Uchiyama ,I., Kamiya,A., Carninci,P., Hayashizaki,Y., Shinozaki,K., Kohara ,Y. and Hasebe,M. Comparative genomics of Physcomitrella patens gametophytic transcriptome and Arabidopsis thaliana: implication for land plant evolution. Proc. Natl. Acad. Sci. U.S.A. 100 (13), 8007-8012 (2003)
DNA ref. Phytozome 12:   scaffold_306 (111177..109752)
Cluster/Prediction ref. UniGene:   Ppa.11595 [5' end]   Ppa.1095 [3' end]
Protein sequence: PpaPrx14
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338 (314)
PWM (Da):   %s   37408.74 (34813.4)  
PI (pH):   %s   8.73 (8.82) Peptide Signal:   %s   cut: 25 range:25-338
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASAWYVRLCAVVIILSLDSFVSASKYDKVHHNSGTHHVPDGGLRDNYYHRSCPHVEKIIFKEISKCFKADKKIAPGILRMSFHDCFVRGCDCSLLLKGNNTERSSRSNANLHGFEALNAAKDAVEKACPGVVSCSDVLQYATRDVVILAGGFGWNVPGGRRDGTVSKVEDVNLTNLPSPRANATNLIQLFESKGMTLAQMVVLSGAHTIGKATCITFDNRLHSDIPEPYADPYSPSFKLYLKSQCPNPNMFVRVNLDSTPEKFDGRYFHDLVHHRGLLTSDQTLMSDSRTRHCVYKNRDDGVFKKNFAEAMVAMSKIGVLTGKDGEIRRRMEVVNSK

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 9 ESTs. Contig also contains PpaPrx09 and 19. Missing 'c'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCGGCCTGGTACGTTCGCCTCTGCGCTGTGGTGATAATATTGAGCTTGGACTCCTTTGTGTCTGCTTCGAAGTATGATAAGGTCCATCATAACTCGGGGACGCATCATGTGCCC
GATGGCGGCTTACGGGACAATTACTACCACCGAAGCTGTCCCCACGTCGAGAAGATTATCTTCAAAGAAATTTCCAAGTGTTTCAAAGCAGACAAGAAGATTGCACCTGGCATCCTACGC
ATGTCATTTCACGACTGCTTTGTCCGG
GTAACTAGACCTTCAGTTTTGTTGACTCTGAGTTGTTAGCGCAGTGCTGTTAGTATTTCGTATTTCCCAACTTTCCTAATATCATTTGAGTAC
ACGGAATATTCTCGAACTGTGCATTCAACATATTCAAAACGACTGCACTTGATTCCTCCAGTGCTTGATAGCTGCTTCTATTATGATCTCTTCAGGGGTGCGACTGCTCCTTGCTTCTGA
AGGGGAATAACACGGAGCGGTCGTCTCGTAGCAACGCTAACTTGCACGGGTTTGAAGCGCTGAACGCTGCGAAGGATGCTGTCGAGAAGGCCTGTCCAGGAGTTGTGTCGTGTTCTGATG
TCCTGCAATACGCTACTCGTGACGTAGTCATACTG
GTATGTTTGATCACTTTTGAGATATAAAAAGCGACCTCTCACTCGTCAATGTGATGCTCTTCTATTTCTATCTGAAACTTCAATC
TGAAAAACAGATGGATATTGCTTGAGTAGGCTGGCGGCTTCGGATGGAACGTGCCTGGTGGCCGCAGAGATGGGACTGTCTCCAAGGTGGAGGATGTAAACTTAACTAATTTGCCCTCTC
CACGCGCGAACGCTACCAACCTAATCCAACTGTTCGAGAGCAAGGGAATGACTCTTGCTCAAATGGTGGTCCTATCAG
GTATGTGGATCTTCACTCACATTCAGTTCGCGCTTATGATTC
AAGTTGAGTACAGTATCAAAGCGAACTAGAAATTACTTGAATCTGACCTTTTATTTTGTTTTTAGGGGCTCACACGATCGGCAAAGCCACCTGCATCACATTCGACAATCGCCTCCACTC
GGATATCCCCGAACCGTATGCCGACCCTTATTCCCCGAGTTTCAAGTTGTACTTGAAGTCGCAGTGCCCTAATCCGAATATGTTTGTCCGTGTGAACTTGGATTCCACTCCAGAAAAATT
TGATGGACGGTATTTCCATGATCTCGTTCACCATCGAGGTCTGTTGACCTCCGATCAGACTCTGATGAGCGACTCCCGCACTAGACACTGCGTTTACAAGAACAGGGACGACGGCGTATT
CAAGAAGAATTTTGCTGAAGCCATGGTAGCCATGAGCAAGATTGGGGTGCTCACTGGGAAGGATGGCGAAATCCGGAGACGTATGGAAGTGGTGAACAGCAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCGGCCTGGTACGTTCGCCTCTGCGCTGTGGTGATAATATTGAGCTTGGACTCCTTTGTGTCTGCTTCGAAGTATGATAAGGTCCATCATAACTCGGGGACGCATCATGTGCCC
GATGGCGGCTTACGGGACAATTACTACCACCGAAGCTGTCCCCACGTCGAGAAGATTATCTTCAAAGAAATTTCCAAGTGTTTCAAAGCAGACAAGAAGATTGCACCTGGCATCCTACGC
ATGTCATTTCACGACTGCTTTGTCCGG
GGGTGCGACTGCTCCTTGCTTCTGAAGGGGAATAACACGGAGCGGTCGTCTCGTAGCAACGCTAACTTGCACGGGTTTGAAGCGCTGAACGCT
GCGAAGGATGCTGTCGAGAAGGCCTGTCCAGGAGTTGTGTCGTGTTCTGATGTCCTGCAATACGCTACTCGTGACGTAGTCATACTG
GCTGGCGGCTTCGGATGGAACGTGCCTGGTGGC
CGCAGAGATGGGACTGTCTCCAAGGTGGAGGATGTAAACTTAACTAATTTGCCCTCTCCACGCGCGAACGCTACCAACCTAATCCAACTGTTCGAGAGCAAGGGAATGACTCTTGCTCAA
ATGGTGGTCCTATCAG
GGGCTCACACGATCGGCAAAGCCACCTGCATCACATTCGACAATCGCCTCCACTCGGATATCCCCGAACCGTATGCCGACCCTTATTCCCCGAGTTTCAAGTTG
TACTTGAAGTCGCAGTGCCCTAATCCGAATATGTTTGTCCGTGTGAACTTGGATTCCACTCCAGAAAAATTTGATGGACGGTATTTCCATGATCTCGTTCACCATCGAGGTCTGTTGACC
TCCGATCAGACTCTGATGAGCGACTCCCGCACTAGACACTGCGTTTACAAGAACAGGGACGACGGCGTATTCAAGAAGAATTTTGCTGAAGCCATGGTAGCCATGAGCAAGATTGGGGTG
CTCACTGGGAAGGATGGCGAAATCCGGAGACGTATGGAAGTGGTGAACAGCAAGTAA

Retrieve as FASTA