Entry information : PpaPrx15
Entry ID 3421
Creation 2008-08-07 (Christophe Dunand)
Last sequence changes 2010-06-07 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: PpaPrx15
Name PpaPrx15
Class Class III peroxidase    [Orthogroup: Prx094]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx15
start..stop
S start..stop
PpaPrx41 600 0 3..411 4..401
PpaPrx37 536 0 68..407 31..370
PpaPrx26 428 1e-149 1..401 1..386
PpaPrx32 314 2e-105 71..374 37..343
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 345406..345966 561 N° 2 346071..346745 675  
join(345406..345966,346071..346745)


exon

Literature and cross-references PpaPrx15
Literature Nishiyama,T., Fujita,T., Shin-i,T., Seki,M., Nishide,H., Uchiyama,I., Kamiya,A., Carninci,P., Hayashizaki,Y., Shinozaki,K., Kohara ,Y. and Hasebe,M. Comparative genomics of Physcomitrella patens gametophytic transcriptome and Arabidopsis thaliana: implication for land plant evolution. Proc. Natl. Acad. Sci. U.S.A. 100 (13), 8007-8012 (2003).
DNA ref. Phytozome 12:   scaffold_201 (345406..346745)
EST ref. GenBank:   FC372111.1 [5' end]   FC372112.1 [3' end]
Cluster/Prediction ref. UniGene:   Ppa.19407   Ppa.3555
Protein sequence: PpaPrx15
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   411 (391)
PWM (Da):   %s   44115.04 (42076.9)  
PI (pH):   %s   6.05 (5.72) Peptide Signal:   %s   cut: 21 range:21-411
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKSFLLIGVIYGLCALSASAWECSFNGRRKVLQVGAPDAAPPQQLEAPSPSAPSSPPLPPQSTVATRPTGADVHGEPPLDYDFYTKSCPSFQQIVKTQVARAILADSLTPAKLLRLFFHDCFVMGCDASLLLNSTVVNLAERDHANNFTVDKYSVIDSIKAELEKACQAIVSCADTLGAAAAEAVEQAGGPHVDLAYGRRDGLESFAPAAKTNLPAGTLQVAGLLENFQNVGLNLTDVVVLSGGHTIGQARCSSFADRFTPGVKNPFPDVSFGENLYTYCVEGNTIGLDRRMSLDTNSTTVFDNGYFRSLVAGRGILTSDNILFTDPRTKPLVTQFAENQDAFFTAFKESMAKMGRIVVLTGTQGQIRKQCWVRNPIDANLRPEANMDFAPQSTKFCRQKPCNPTCSDPAS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 2) and 4 ESTs. Strain = "Villersexel 2003".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGTCGTTTCTGCTAATCGGAGTGATATATGGCTTGTGTGCCTTGAGTGCATCCGCTTGGGAGTGTTCATTCAATGGGCGGCGCAAAGTGCTCCAAGTTGGGGCTCCAGATGCAGCC
CCACCACAGCAACTAGAAGCTCCTTCACCTTCAGCGCCATCTTCACCACCACTACCCCCGCAATCGACTGTGGCTACACGCCCAACGGGTGCAGATGTGCACGGCGAACCCCCACTAGAT
TACGATTTCTATACCAAGTCGTGCCCGTCATTTCAGCAAATTGTGAAGACCCAGGTCGCTAGAGCCATTCTAGCAGACTCCCTCACTCCCGCAAAGTTACTTCGTTTGTTCTTTCATGAC
TGCTTCGTGATGGGTTGCGATGCGTCTCTGCTGCTCAATTCTACCGTGGTGAACCTCGCGGAGCGAGATCACGCTAACAACTTCACTGTCGACAAATACTCTGTCATAGACTCAATAAAG
GCCGAGCTCGAGAAAGCCTGCCAGGCCATAGTGTCATGTGCTGACACCCTCGGCGCCGCTGCTGCGGAGGCTGTGGAACAA
GTAAGGGTTCACGATTGTCCTATCTTGCTTCTAGAATTA
TATCCACGCAGGATTAGGTCTTGAACGATTATGGATTAGCTCACGGTGCTCTGCTCTGTTGCTAGGCGGGAGGACCACACGTCGACCTAGCATATGGCCGACGGGATGGACTCGAATCTT
TCGCACCGGCCGCAAAGACGAATTTGCCAGCCGGCACGCTTCAAGTCGCAGGGCTGCTAGAGAATTTCCAGAACGTAGGACTGAATCTCACCGATGTGGTGGTGCTCTCTGGCGGTCACA
CAATCGGTCAAGCACGGTGCTCCTCATTTGCCGATCGGTTCACACCAGGAGTGAAAAACCCTTTCCCCGACGTCTCATTCGGAGAGAACCTGTACACTTACTGCGTCGAAGGCAATACAA
TAGGCCTCGACCGCAGAATGTCGCTCGACACCAACAGCACCACAGTCTTCGACAATGGCTATTTTCGGAGCTTAGTCGCAGGTCGCGGCATCTTGACATCGGACAACATTCTGTTCACTG
ACCCTCGCACCAAGCCGCTAGTCACTCAATTCGCGGAGAACCAGGATGCATTCTTCACCGCATTCAAGGAATCCATGGCGAAGATGGGTCGCATCGTAGTCCTCACAGGCACTCAAGGAC
AGATCCGCAAGCAGTGCTGGGTGCGCAATCCCATCGATGCCAACCTAAGGCCTGAGGCGAACATGGACTTCGCTCCCCAGAGCACCAAGTTCTGCAGGCAGAAGCCTTGCAATCCCACAT
GCTCCGACCCTGCTTCATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGTCGTTTCTGCTAATCGGAGTGATATATGGCTTGTGTGCCTTGAGTGCATCCGCTTGGGAGTGTTCATTCAATGGGCGGCGCAAAGTGCTCCAAGTTGGGGCTCCAGATGCAGCC
CCACCACAGCAACTAGAAGCTCCTTCACCTTCAGCGCCATCTTCACCACCACTACCCCCGCAATCGACTGTGGCTACACGCCCAACGGGTGCAGATGTGCACGGCGAACCCCCACTAGAT
TACGATTTCTATACCAAGTCGTGCCCGTCATTTCAGCAAATTGTGAAGACCCAGGTCGCTAGAGCCATTCTAGCAGACTCCCTCACTCCCGCAAAGTTACTTCGTTTGTTCTTTCATGAC
TGCTTCGTGATGGGTTGCGATGCGTCTCTGCTGCTCAATTCTACCGTGGTGAACCTCGCGGAGCGAGATCACGCTAACAACTTCACTGTCGACAAATACTCTGTCATAGACTCAATAAAG
GCCGAGCTCGAGAAAGCCTGCCAGGCCATAGTGTCATGTGCTGACACCCTCGGCGCCGCTGCTGCGGAGGCTGTGGAACAA
GCGGGAGGACCACACGTCGACCTAGCATATGGCCGACGG
GATGGACTCGAATCTTTCGCACCGGCCGCAAAGACGAATTTGCCAGCCGGCACGCTTCAAGTCGCAGGGCTGCTAGAGAATTTCCAGAACGTAGGACTGAATCTCACCGATGTGGTGGTG
CTCTCTGGCGGTCACACAATCGGTCAAGCACGGTGCTCCTCATTTGCCGATCGGTTCACACCAGGAGTGAAAAACCCTTTCCCCGACGTCTCATTCGGAGAGAACCTGTACACTTACTGC
GTCGAAGGCAATACAATAGGCCTCGACCGCAGAATGTCGCTCGACACCAACAGCACCACAGTCTTCGACAATGGCTATTTTCGGAGCTTAGTCGCAGGTCGCGGCATCTTGACATCGGAC
AACATTCTGTTCACTGACCCTCGCACCAAGCCGCTAGTCACTCAATTCGCGGAGAACCAGGATGCATTCTTCACCGCATTCAAGGAATCCATGGCGAAGATGGGTCGCATCGTAGTCCTC
ACAGGCACTCAAGGACAGATCCGCAAGCAGTGCTGGGTGCGCAATCCCATCGATGCCAACCTAAGGCCTGAGGCGAACATGGACTTCGCTCCCCAGAGCACCAAGTTCTGCAGGCAGAAG
CCTTGCAATCCCACATGCTCCGACCCTGCTTCATAG

Retrieve as FASTA