Entry information : PpaPrx16
Entry ID 3427
Creation 2008-08-07 (Christophe Dunand)
Last sequence changes 2011-01-25 (Toky Ramarohetra (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: PpaPrx16
Name PpaPrx16
Class Class III peroxidase    [Orthogroup: Prx176]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation Apoplastic
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx16
start..stop
S start..stop
PpaPrx03 514 0 1..325 1..325
PpaPrx10 421 4e-149 1..325 1..328
PpaPrx08 366 2e-127 1..325 1..321
SmPrx35-1_84 308 7e-105 25..325 14..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 131388..131633 246 N° 2 131026..131205 180 N° 3 130751..130916 166 N° 4 130262..130647 386
complement(join(130262..130647,130751..130916,131026..131205,131388..131633))


exon

Literature and cross-references PpaPrx16
Literature Rensing,S. et al., The genome of the moss Physcomitrella patens reveals evolutionary insights into the conquest of land by plants. Science (2008) In press.
DNA ref. Phytozome 12:   scaffold_356 (131633..130262)
EST ref. GenBank:   BJ966066 [5' end]   BJ974586 [3' end]
Protein sequence: PpaPrx16
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325
PWM (Da):   %s   35045.19  
PI (pH):   %s   6.97
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEMRLHSKKRKPALWTVMAMMIAQLIFHPRMCTGGALRPGYYAQTCPNAENIIRAAMEWGMQQDSGTAPGVLRLHFHDCFVDGCDGSVLLEGPTSEKTAPPNSSLRGFEVIDAAKAELEATCPGVVSCADILAYCARDAVIMTGGLGWPVEAGRLDGRSSDASRANAEIPDPSFNVAQLIDSFARKGLTRSDMIVLSGAHTIGRANCKSVATRLYPVQDPRLSEPLAAELKSGCPQQGGSATFNLDSTPDRFDNNYYANVVNGRGIMNSDQVLFDDPSTRPETTFNAVGSAPWAFRFSQIMLKMGTIDVKTGPQGEIRRNCRSVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 5 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGATGAGACTTCACTCGAAGAAGAGGAAACCTGCTTTGTGGACTGTGATGGCCATGATGATAGCGCAGCTGATCTTTCATCCTCGAATGTGCACCGGGGGAGCGTTGCGACCGGGA
TATTATGCTCAGACCTGTCCAAATGCGGAGAATATTATACGGGCGGCTATGGAGTGGGGAATGCAACAGGACAGTGGAACTGCGCCAGGCGTTCTTCGACTTCATTTCCACGACTGCTTT
GTAGAT
GTAAGTAGCGAGCATCTTCAAGCAAATGCCAGTTTCCAATAGACCATGAAATTCGACATCACTCAATCCAAATTAAATGGCGAATCCTTAATTGAGCAGTAAGAACGAGAGATT
CAATTCTCCCCTTCAGGAAAAATAATAAAGCATAGTTAATTCACCTCGGAGCTTGACTGTGAATACAGGGATGTGACGGATCAGTGCTTCTCGAAGGACCGACATCGGAGAAAACAGCAC
CTCCAAACTCCAGTCTACGAGGATTCGAGGTAATTGATGCGGCAAAGGCAGAACTGGAAGCTACATGTCCAGGAGTGGTCTCGTGCGCTGACATTCTGGCATATTGTGCTCGCGACGCTG
TAATTATG
GTAAGCTCGCGAACAAGCTATATCGTTTCAGTTCTTTGATTCTGTCTATTTAACCGTTTTATGTCTCCCCTCTGAACACAATGCACACACACTATTGTCTCTCTGGTAGACG
GGTGGGTTAGGATGGCCTGTCGAAGCAGGTAGACTTGACGGTCGCTCTTCCGACGCTAGCAGAGCGAATGCCGAGATACCGGACCCAAGCTTCAACGTGGCCCAGCTCATCGACTCATTT
GCTCGCAAGGGGTTGACCAGGAGTGACATGATTGTTCTCTCAG
GTATCTATTCCCATTCTCTCAGCGTAAGTTCTCTCCAATTCCACGCACGCTCAAGGTTCAATCTCCTCACCCATTCT
GATGCTCATAAAGCTCACCACGGCAGGCGCGCACACCATCGGCCGCGCCAACTGCAAATCCGTGGCGACCAGGCTCTACCCAGTCCAAGACCCCAGACTGAGTGAGCCTCTCGCCGCCGA
ACTGAAATCTGGGTGTCCGCAGCAAGGAGGTAGTGCGACGTTCAACTTGGATTCCACCCCAGACCGATTCGACAACAACTATTACGCCAATGTTGTGAACGGACGCGGCATCATGAACTC
CGATCAGGTGCTGTTTGACGACCCCTCGACGCGCCCTGAAACCACGTTTAACGCCGTGGGTTCAGCGCCGTGGGCATTCCGGTTCAGCCAAATCATGCTCAAAATGGGAACAATCGACGT
CAAAACTGGTCCCCAGGGCGAAATCCGCCGCAATTGCAGGTCGGTTAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGATGAGACTTCACTCGAAGAAGAGGAAACCTGCTTTGTGGACTGTGATGGCCATGATGATAGCGCAGCTGATCTTTCATCCTCGAATGTGCACCGGGGGAGCGTTGCGACCGGGA
TATTATGCTCAGACCTGTCCAAATGCGGAGAATATTATACGGGCGGCTATGGAGTGGGGAATGCAACAGGACAGTGGAACTGCGCCAGGCGTTCTTCGACTTCATTTCCACGACTGCTTT
GTAGAT
GGATGTGACGGATCAGTGCTTCTCGAAGGACCGACATCGGAGAAAACAGCACCTCCAAACTCCAGTCTACGAGGATTCGAGGTAATTGATGCGGCAAAGGCAGAACTGGAAGCT
ACATGTCCAGGAGTGGTCTCGTGCGCTGACATTCTGGCATATTGTGCTCGCGACGCTGTAATTATG
ACGGGTGGGTTAGGATGGCCTGTCGAAGCAGGTAGACTTGACGGTCGCTCTTCC
GACGCTAGCAGAGCGAATGCCGAGATACCGGACCCAAGCTTCAACGTGGCCCAGCTCATCGACTCATTTGCTCGCAAGGGGTTGACCAGGAGTGACATGATTGTTCTCTCAG
GCGCGCAC
ACCATCGGCCGCGCCAACTGCAAATCCGTGGCGACCAGGCTCTACCCAGTCCAAGACCCCAGACTGAGTGAGCCTCTCGCCGCCGAACTGAAATCTGGGTGTCCGCAGCAAGGAGGTAGT
GCGACGTTCAACTTGGATTCCACCCCAGACCGATTCGACAACAACTATTACGCCAATGTTGTGAACGGACGCGGCATCATGAACTCCGATCAGGTGCTGTTTGACGACCCCTCGACGCGC
CCTGAAACCACGTTTAACGCCGTGGGTTCAGCGCCGTGGGCATTCCGGTTCAGCCAAATCATGCTCAAAATGGGAACAATCGACGTCAAAACTGGTCCCCAGGGCGAAATCCGCCGCAAT
TGCAGGTCGGTTAACTAA

Retrieve as FASTA