Entry information : PpaPrx18
Entry ID 3429
Creation 2006-07-28 (Christophe Dunand)
Last sequence changes 2006-07-28 (Christophe Dunand)
Sequence status complete
Reviewer Filippo Passardi
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: PpaPrx18
Name PpaPrx18
Class Class III peroxidase    [Orthogroup: Prx177]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx18
start..stop
S start..stop
PpaPrx09 418 8e-148 14..335 9..329
PpaPrx19 413 9e-146 7..337 6..325
TruPrx01 413 1e-145 4..332 1..324
MePrx35 318 1e-108 34..332 19..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 715727..715978 252 N° 2 716246..716437 192 N° 3 716593..716761 169 N° 4 716916..717325 410
join(715727..715978,716246..716437,716593..716761,716916..717325)


exon

Literature and cross-references PpaPrx18
Literature Nishiyama,T., Fujita,T., Sakakibara,K., Shin-i,T., Kohara,Y. and Hasebe,M. Physcomitrella patens EST from young sporophytes with surrounding archegonia. Unpublished (2005)
DNA ref. Phytozome 12:   scaffold_60 (715727..717325)
Cluster/Prediction ref. UniGene:   Ppa.8192
Protein sequence: PpaPrx18
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   340 (310)
PWM (Da):   %s   36959.04 (34091.4) Transmb domain:   %s   i13-35o
PI (pH):   %s   8.39 (7.98) Peptide Signal:   %s   cut: 31 range:31-340
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKAMGASGAVMAVRVLSVVVLLAVVSTVGAEAVVASGLLTTDYYARSCPRLSSIVKEEVQKAVKVEKRMAASLVRLHFHDCFVHGCDGSILLDDTATFIGEKTAAANNNSARGFEVIDGIKAKLEEACPKTVSCADILALASRDSAVEVGLSERYPVFVGRLDSLNASRDEANLRLPSPRANYSELKKNFEFQGLNEVDLIALSGAHTIGKVRCQIVRLFLNDTDTNAEFRSNLAKECPAGGDDFKLQNLDLKTPEKFDNNYFKNLRRGEGIIRSDQTLWSTPGINQAIVWDFARNQKTFFRQFAFSTIKMGNIRPPAGTKGEIRENCRAVNSAPLVASE

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 47 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGCGATGGGGGCTTCGGGAGCTGTGATGGCGGTGCGGGTTCTGTCGGTTGTGGTGCTGCTGGCGGTAGTGTCTACCGTCGGCGCTGAAGCTGTAGTAGCTTCGGGTTTGTTAACC
ACGGACTACTACGCCCGTTCGTGCCCTCGACTCTCCTCAATTGTCAAGGAAGAGGTTCAGAAGGCTGTGAAGGTCGAGAAACGGATGGCGGCTTCCCTTGTTCGCCTCCATTTTCATGAT
TGCTTCGTCCAT
GTGAGTACTGTGTCGCCGATGCCGAGGTCGTGTCAGAATGATGTCTGGAGCATGGTCGGTGGTGACTGTCTCACTCTACTACTAGTTCGGTTGTGGAAATTAAGGACA
GGCACGGTTTTAGTACTCGACTATATGTGTGTCAAAAGAACGGTTTCCATGGCCATGTTGTTGGAATTGTAGTTACTACACGATTTTGAACAGGCAATAGATTTTTGGCGCTGCGGCCTT
TGTGTTGCGAAGTACTTGGCTGAGTTGGAGTTTTGGTAGGGATGCGATGGGTCAATTCTATTGGATGATACGGCAACTTTCATCGGAGAAAAGACTGCAGCCGCAAATAACAATTCAGCA
AGAGGTTTTGAGGTGATTGACGGTATTAAGGCCAAGTTAGAGGAGGCTTGTCCAAAAACAGTGTCGTGTGCGGATATTCTTGCACTCGCTTCGAGGGACTCTGCTGTTGAG
GTAAATATA
TTCATCTCTGCAGACTGGCGTTGTGATGTTCACATCACAACTCACAATGGAAGATATACTGTGGTTAAACAATTTCTTGTATCTTTCAATTTCTGCAAGCTCATCGGAAGTTTGTGTTCA
CATGGGGCCCTGGTTGCATGTCGCAGGTGGGATTGTCCGAGAGATATCCAGTGTTCGTCGGTCGTCTCGACAGCCTGAACGCAAGTCGCGATGAAGCCAATTTAAGACTACCATCTCCTC
GAGCCAATTACAGCGAACTAAAAAAGAACTTTGAATTTCAAGGACTTAACGAAGTTGATCTTATCGCACTCTCAG
GTACTAAGTTCTAGTTGCAATTCTAAACTATACTCCAGTACAGAT
ACGACAAGTCGGCAACGATTAGAGACTGATATGATGAGCTAGACAAAGTAGCACTGAGCTACCGATTTACACTTTTCATGCCTGATTCTCTCATTTGTGGCATTCTCAGGTGCTCACACA
ATTGGCAAAGTCAGATGCCAGATTGTCAGGCTCTTCCTGAACGACACCGACACCAACGCTGAATTCCGCAGTAACCTTGCTAAAGAGTGTCCAGCGGGTGGAGACGACTTCAAATTGCAA
AACCTGGATCTTAAAACCCCTGAAAAATTCGACAATAACTATTTCAAGAATTTGCGAAGAGGCGAGGGTATTATCCGAAGCGATCAGACGCTGTGGAGCACGCCGGGCATTAATCAAGCC
ATTGTCTGGGACTTTGCTCGCAATCAGAAGACTTTCTTCCGACAGTTTGCCTTCAGTACCATCAAGATGGGCAATATCAGACCTCCCGCTGGCACAAAGGGAGAAATCAGAGAGAATTGC
AGGGCGGTGAACTCTGCTCCCCTTGTTGCATCCGAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGCGATGGGGGCTTCGGGAGCTGTGATGGCGGTGCGGGTTCTGTCGGTTGTGGTGCTGCTGGCGGTAGTGTCTACCGTCGGCGCTGAAGCTGTAGTAGCTTCGGGTTTGTTAACC
ACGGACTACTACGCCCGTTCGTGCCCTCGACTCTCCTCAATTGTCAAGGAAGAGGTTCAGAAGGCTGTGAAGGTCGAGAAACGGATGGCGGCTTCCCTTGTTCGCCTCCATTTTCATGAT
TGCTTCGTCCAT
GGATGCGATGGGTCAATTCTATTGGATGATACGGCAACTTTCATCGGAGAAAAGACTGCAGCCGCAAATAACAATTCAGCAAGAGGTTTTGAGGTGATTGACGGTATT
AAGGCCAAGTTAGAGGAGGCTTGTCCAAAAACAGTGTCGTGTGCGGATATTCTTGCACTCGCTTCGAGGGACTCTGCTGTTGAG
GTGGGATTGTCCGAGAGATATCCAGTGTTCGTCGGT
CGTCTCGACAGCCTGAACGCAAGTCGCGATGAAGCCAATTTAAGACTACCATCTCCTCGAGCCAATTACAGCGAACTAAAAAAGAACTTTGAATTTCAAGGACTTAACGAAGTTGATCTT
ATCGCACTCTCAG
GTGCTCACACAATTGGCAAAGTCAGATGCCAGATTGTCAGGCTCTTCCTGAACGACACCGACACCAACGCTGAATTCCGCAGTAACCTTGCTAAAGAGTGTCCAGCG
GGTGGAGACGACTTCAAATTGCAAAACCTGGATCTTAAAACCCCTGAAAAATTCGACAATAACTATTTCAAGAATTTGCGAAGAGGCGAGGGTATTATCCGAAGCGATCAGACGCTGTGG
AGCACGCCGGGCATTAATCAAGCCATTGTCTGGGACTTTGCTCGCAATCAGAAGACTTTCTTCCGACAGTTTGCCTTCAGTACCATCAAGATGGGCAATATCAGACCTCCCGCTGGCACA
AAGGGAGAAATCAGAGAGAATTGCAGGGCGGTGAACTCTGCTCCCCTTGTTGCATCCGAGTAG

Retrieve as FASTA