Entry information : PpaPrx20
Entry ID 3431
Creation 2006-07-28 (Christophe Dunand)
Last sequence changes 2006-07-28 (Christophe Dunand)
Sequence status complete
Reviewer Filippo Passardi
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: PpaPrx20
Name PpaPrx20
Class Class III peroxidase    [Orthogroup: Prx178]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx20
start..stop
S start..stop
PpaPrx30 515 0 15..314 20..319
PpaPrx21 512 0 21..312 26..317
PpaPrx12 511 0 14..314 20..320
PpaPrx34 294 2e-99 20..312 19..313
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 929080..929292 213 N° 2 927874..928222 349 N° 3 927361..927743 383  
complement(join(927361..927743,927874..928222,929080..929292))


exon

Literature and cross-references PpaPrx20
Literature Rensing,S. et al., The genome of the moss Physcomitrella patens reveals evolutionary insights into the conquest of land by plants. Science (2008).
DNA ref. Phytozome 12:   scaffold_62 (929292..927361)
Cluster/Prediction ref. UniGene:   Ppa.10307
Protein sequence: PpaPrx20
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   314 (292)
PWM (Da):   %s   33337.37 (31113.1)  
PI (pH):   %s   4.56 (4.60) Peptide Signal:   %s   cut: 23 range:23-314
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRLLALELLTAAFLLAAVADAELRYGYYDSLGCAGVEDRVRTLVRRSFLTDATSSAAMLRLAFHDCQVGPGGCDGSIMMEGDGGEMDAGSNFGVKRLDIINSVKSDMEDMCPLTVSCADIIAMAGRDAVAYNGGPEIQIPLGRKDADFSSATEAEAKLPPATSNVDRVLNVFAPFGMSIAESVAILGAHTLGVGHCKNIQDRLQLNSPTAPNSVVYRTQLRAACAVNVFDIAILNNDASQFTFDNQYFQDIQNGRGLFTVDDQLSTDPRTAPIVTLYASNQGAFFSAFQSAYVKLTSRAMTGNQGSVRSTCTL

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 3) and 21 ESTs + BJ590191 + BJ582780
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGAGATTGTTGGCGTTGGAGCTCCTCACCGCTGCTTTCCTGCTGGCGGCGGTGGCGGACGCTGAGCTGCGGTATGGCTACTATGATTCGTTGGGGTGTGCGGGGGTGGAGGATAGA
GTGCGAACCTTGGTGCGGCGGAGCTTCCTTACAGATGCTACTTCAAGTGCTGCAATGCTCCGCCTTGCTTTTCATGACTGTCAAGTCGGACCT
GTGAGTACCTCACACCTTAACGTAACA
AGACCGGCTTGCCATTCCTTGAGCTCATATTCCTATCGATGTCCTTCAGGTCTTCTGCTTATCAACACTCAGGAGATAACTGTGTGAAAATACTAAGTTCATGTTTTTAGTAATGTCGTT
TTTCCAAACCTCTCCGCCAGCATTTACCGACATGGATTACGTTGTCTGCAAAAAAAGGAAGTGGTGTTGTTACCACATACATTAGCCCCCCTCCCCTGCTTGCCTCGCTGACATTGCACT
AATGCTTTACTTACAACAATTGTAGGCTCCATCCTTTCCCCAGGTGGTATTACATCTTAGCTTTGCACTTGCACTTACTCACGTTGACGCCGTCGGTAGAATACACAAGAACTTCCATGG
TAGTAATGCCGTGTCTGGAAGTTGACAGTGAAGACTTTTCTCGGTCAAACACAGATAGGTAGCTCTTTTACACATCTAATATTAAGGTAGTAGCACTTTGAGTCAGAAATTGGGAGTTTT
ACTCGAAAGTATTTGTGCTAATTGATACTTTGGACAGTCTCGAATGCTTCTAATAGATCCTGAAATTAAATAACCTTGTGCTGACAGCAGGAGGGAAATTACTTTCTAATGAGAATGAAT
ACTGAGGAACTTGTATTTGTTATTGCTAATTCATTGATAGTAGCAACTCTTTTAGCAGTCTACTCAAACGAATTAGCAACCAAATTTCTGAGCTTACTTGTTGGGAGTGTTGTGTGGCTC
GTGTTGTTGCTTCTGCTCCATTGCTTTCTCACATGCTCCTCCGTTGACCATGTTTGTTCAGAGGGCAATAGTTCAATTCTGGAATGTAAGGGTAGTTTCTCTTTGTGCAGGGAGGGTGCG
ATGGCTCCATCATGATGGAAGGCGATGGCGGGGAAATGGACGCTGGCAGTAACTTTGGAGTCAAGCGCCTGGATATCATCAACTCCGTCAAATCTGACATGGAGGATATGTGCCCGTTGA
CGGTTTCCTGCGCAGACATTATCGCTATGGCTGGACGGGACGCAGTTGCTTACAATGGCGGCCCTGAAATTCAAATTCCTCTCGGCAGGAAGGATGCTGATTTCTCTAGTGCAACTGAAG
CCGAAGCCAAACTCCCACCTGCTACCTCCAATGTGGACAGAGTTCTCAATGTTTTTGCCCCCTTCGGCATGAGCATAGCCGAGAGTGTTGCCATTCTAG
GTACGCTAGCTTTTCCGTATC
ATGAGCGATTGTATTTACCAAGCCTGCAAAGAAGTTATTGTTTGAACCCACAAGCTTCCTTGAATTCGTTCACTCTCTGAATCTTAGCCGTCTTTATTTTTGTTTGCAGGTGCTCACACT
CTCGGAGTAGGACACTGTAAAAACATCCAAGATCGTCTGCAGCTTAATAGTCCAACTGCCCCAAACAGTGTCGTCTATCGCACTCAACTCCGGGCAGCATGTGCTGTAAATGTGTTCGAT
ATCGCAATCCTCAACAATGACGCCTCTCAGTTCACATTCGACAACCAGTACTTCCAAGACATTCAGAACGGACGCGGTCTCTTCACCGTCGACGACCAGCTTAGCACGGATCCACGCACA
GCCCCCATCGTCACGCTCTACGCCTCTAACCAGGGAGCCTTCTTCTCTGCCTTCCAATCAGCCTATGTGAAGTTGACCTCACGAGCCATGACAGGAAATCAAGGCAGCGTGAGGAGCACT
TGCACTCTCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGAGATTGTTGGCGTTGGAGCTCCTCACCGCTGCTTTCCTGCTGGCGGCGGTGGCGGACGCTGAGCTGCGGTATGGCTACTATGATTCGTTGGGGTGTGCGGGGGTGGAGGATAGA
GTGCGAACCTTGGTGCGGCGGAGCTTCCTTACAGATGCTACTTCAAGTGCTGCAATGCTCCGCCTTGCTTTTCATGACTGTCAAGTCGGACCT
GGAGGGTGCGATGGCTCCATCATGATG
GAAGGCGATGGCGGGGAAATGGACGCTGGCAGTAACTTTGGAGTCAAGCGCCTGGATATCATCAACTCCGTCAAATCTGACATGGAGGATATGTGCCCGTTGACGGTTTCCTGCGCAGAC
ATTATCGCTATGGCTGGACGGGACGCAGTTGCTTACAATGGCGGCCCTGAAATTCAAATTCCTCTCGGCAGGAAGGATGCTGATTTCTCTAGTGCAACTGAAGCCGAAGCCAAACTCCCA
CCTGCTACCTCCAATGTGGACAGAGTTCTCAATGTTTTTGCCCCCTTCGGCATGAGCATAGCCGAGAGTGTTGCCATTCTAG
GTGCTCACACTCTCGGAGTAGGACACTGTAAAAACATC
CAAGATCGTCTGCAGCTTAATAGTCCAACTGCCCCAAACAGTGTCGTCTATCGCACTCAACTCCGGGCAGCATGTGCTGTAAATGTGTTCGATATCGCAATCCTCAACAATGACGCCTCT
CAGTTCACATTCGACAACCAGTACTTCCAAGACATTCAGAACGGACGCGGTCTCTTCACCGTCGACGACCAGCTTAGCACGGATCCACGCACAGCCCCCATCGTCACGCTCTACGCCTCT
AACCAGGGAGCCTTCTTCTCTGCCTTCCAATCAGCCTATGTGAAGTTGACCTCACGAGCCATGACAGGAAATCAAGGCAGCGTGAGGAGCACTTGCACTCTCTAG

Retrieve as FASTA