Entry information : PpaPrx21
Entry ID 3432
Creation 2008-08-06 (Christophe Dunand)
Last sequence changes 2011-01-25 (Toky Ramarohetra (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: PpaPrx21
Name PpaPrx21
Class Class III peroxidase    [Orthogroup: Prx178]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx21
start..stop
S start..stop
PpaPrx12 528 0 1..317 1..318
PpaPrx20 509 0 28..317 23..312
PpaPrx30 483 1e-173 1..317 1..317
PpaPrx34 285 6e-96 25..317 19..313
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 471223..471450 228 N° 2 472160..472508 349 N° 3 472610..472992 383  
join(471223..471450,472160..472508,472610..472992)


exon

Literature and cross-references PpaPrx21
Literature Rensing,S. et al., The genome of the moss Physcomitrella patens reveals evolutionary insights into the conquest of land by plants. Science (2008).
DNA ref. Phytozome 12:   scaffold_44 (471223..472992)
Cluster/Prediction ref. UniGene:   Ppa.2308
Protein sequence: PpaPrx21
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (292)
PWM (Da):   %s   33621.86 (30997.4) Transmb domain:   %s   i2-24o
PI (pH):   %s   7.31 (7.70) Peptide Signal:   %s   cut: 28 range:28-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASWTVTLLVGAAVAVVVTNLAAVTDAELQYGYYDRVGCFGVENRVRTLVRRSFIADVTASAAMLRLAFHDCQVGPGGCDGSIMIEGNGGEMSSGNNFGVKRLDIINSVKADMEKMCPTTVSCADIIAMAGRDAVAFNGGPDIKIPLGRKDAVSSSATEADAKLPPATSSIDRVFNVFGAFGMTHEESVAILGAHTIGVGHCKSIQDRLQSNSPTAPNSLVFRTQLTAACAVNVFNIAVLTNDATQFTFDNQYFKDIQNGRGLFTVDNLLSIDPRTAPIVNTYAANKGAFFAAFQSAYVKLTSRALKGNQGSVRSTCLH

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 3) and 3 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGCTGGACAGTGACATTGCTGGTGGGTGCAGCTGTTGCAGTGGTGGTTACTAATCTCGCGGCGGTAACGGATGCAGAGCTGCAATACGGGTACTACGATAGGGTGGGATGTTTT
GGGGTGGAGAATAGAGTGCGAACTCTGGTGCGGAGGAGCTTCATCGCTGACGTTACAGCTAGTGCAGCCATGCTTCGCCTTGCCTTTCATGACTGCCAAGTTGGGCCG
GTAAGACCTGGA
TCCACACATTCAAGTGCAGGGCAATGGCCGTGCCCCATTTCATACTTTTTTGTGATTGGTTTCTGACAAGCTTTCTATTGAGATGTGTTCCTCTGCAGCTGGACTTCCTGCAGGTACGTC
ATCTCCGCTGAGGTACCAAACTCTGCAGCTGAGTTGCCTCGAAGTGCATCCTGAAATTGCATCTGTTGTATGTTGTAGTCTGCACATCGTGACGGGAAGTCCTGATTACACGTTAAATGA
CAAGTTCTATAGCCTCTCGCCTAACATTTTGTGTAGAATTTCCAGAAGTTTCAATAAGTGTTCTCATCAAGAGCAGTCTTCACTACTCGCCTTACAAAAACTTCACACGAGAGTAGACGA
GATGAACGACTCAGGGTGAGAGAAGTTCTGATAATTATGATGAACTTCTGGAAATTTTTGAAATCGACAGTGGTTCTGAGTCAGTCGCAGATTGTTTATATACAATCGAAAGTGAAAGAC
ACACGTTTAATAATACTTGCATTCCACATCTTTGCATCGATTGAGAAGATTACTGAATGCTGCGCACCTTTTCGAAGATATTCTATGTGGTACTGAGGTCGCCTCATGTGATATTTCGTG
CTAGTCAGTTGAACATAATCACTGAGCTGAGATAAAGAGCTGTATGACTTGTTTCATGATTTGGTTCGCCCGTTGACACGGCTTTTCATTTTTGAAGGGAGGTTGCGATGGCTCAATCAT
GATAGAGGGCAATGGAGGAGAAATGTCGTCTGGGAACAATTTTGGCGTCAAGCGCCTCGACATCATCAACTCTGTGAAAGCCGATATGGAGAAGATGTGTCCGACCACAGTTTCATGTGC
TGATATCATCGCAATGGCGGGACGTGACGCTGTTGCCTTCAATGGCGGCCCTGACATCAAGATTCCTCTAGGCAGAAAGGATGCCGTTTCCTCAAGCGCTACTGAAGCAGATGCTAAACT
TCCTCCAGCCACCTCCAGCATCGACAGGGTTTTTAATGTCTTTGGCGCATTCGGCATGACTCATGAAGAGAGCGTTGCCATTTTAG
GTACGAATGCAGATTCAAGTTTTGTGACATCGAT
GTTCTTTATCAAGTCGTTTTACTCTAGTCAGTGTTTCTGACTCGAAGTCCTTTTGTCTGTCCTGCAGGTGCGCACACCATTGGTGTGGGGCACTGCAAAAGTATTCAAGATCGTCTGCAA
TCCAACAGCCCAACTGCTCCAAACAGCTTAGTTTTCCGTACTCAACTCACTGCAGCTTGTGCAGTGAATGTCTTCAACATCGCCGTTCTGACCAACGACGCCACTCAGTTCACTTTCGAC
AACCAGTACTTCAAAGATATTCAAAACGGACGTGGCCTCTTCACCGTCGACAATCTGCTCAGCATCGATCCACGCACTGCTCCTATCGTCAACACCTACGCTGCTAACAAAGGTGCCTTC
TTCGCGGCATTCCAATCGGCGTATGTGAAACTGACCTCGCGAGCACTGAAAGGCAATCAAGGAAGCGTAAGAAGCACCTGCCTGCATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGCTGGACAGTGACATTGCTGGTGGGTGCAGCTGTTGCAGTGGTGGTTACTAATCTCGCGGCGGTAACGGATGCAGAGCTGCAATACGGGTACTACGATAGGGTGGGATGTTTT
GGGGTGGAGAATAGAGTGCGAACTCTGGTGCGGAGGAGCTTCATCGCTGACGTTACAGCTAGTGCAGCCATGCTTCGCCTTGCCTTTCATGACTGCCAAGTTGGGCCG
GGAGGTTGCGAT
GGCTCAATCATGATAGAGGGCAATGGAGGAGAAATGTCGTCTGGGAACAATTTTGGCGTCAAGCGCCTCGACATCATCAACTCTGTGAAAGCCGATATGGAGAAGATGTGTCCGACCACA
GTTTCATGTGCTGATATCATCGCAATGGCGGGACGTGACGCTGTTGCCTTCAATGGCGGCCCTGACATCAAGATTCCTCTAGGCAGAAAGGATGCCGTTTCCTCAAGCGCTACTGAAGCA
GATGCTAAACTTCCTCCAGCCACCTCCAGCATCGACAGGGTTTTTAATGTCTTTGGCGCATTCGGCATGACTCATGAAGAGAGCGTTGCCATTTTAG
GTGCGCACACCATTGGTGTGGGG
CACTGCAAAAGTATTCAAGATCGTCTGCAATCCAACAGCCCAACTGCTCCAAACAGCTTAGTTTTCCGTACTCAACTCACTGCAGCTTGTGCAGTGAATGTCTTCAACATCGCCGTTCTG
ACCAACGACGCCACTCAGTTCACTTTCGACAACCAGTACTTCAAAGATATTCAAAACGGACGTGGCCTCTTCACCGTCGACAATCTGCTCAGCATCGATCCACGCACTGCTCCTATCGTC
AACACCTACGCTGCTAACAAAGGTGCCTTCTTCGCGGCATTCCAATCGGCGTATGTGAAACTGACCTCGCGAGCACTGAAAGGCAATCAAGGAAGCGTAAGAAGCACCTGCCTGCATTAA

Retrieve as FASTA