Entry information : PpaPrx26 (PP00056G00280)
Entry ID 3437
Creation 2009-08-17 (Christophe Dunand)
Last sequence changes 2011-01-25 (Toky Ramarohetra (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: PpaPrx26 (PP00056G00280)
Name (synonym) PpaPrx26 (PP00056G00280)
Class Class III peroxidase    [Orthogroup: Prx094]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx26
start..stop
S start..stop
PpaPrx41 433 1e-151 3..395 4..395
PpaPrx15 424 8e-148 1..386 1..401
PpaPrx37 401 2e-139 43..386 27..364
PpaPrx32 268 1e-87 18..359 16..343
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 420108..420620 513 N° 2 419809..419974 166 N° 3 419147..419652 506  
complement(join(419147..419652,419809..419974,420108..420620))


exon

Literature and cross-references PpaPrx26 (PP00056G00280)
Literature Rensing,S. et al., The genome of the moss Physcomitrella patens reveals evolutionary insights into the conquest of land by plants. Science (2008).
DNA ref. Phytozome 12:   scaffold_56 (420620..419147)
Cluster/Prediction ref. UniGene:   Ppa.3120
Protein sequence: PpaPrx26 (PP00056G00280)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   395 (371)
PWM (Da):   %s   42256.12 (39855.8) Transmb domain:   %s   i7-29o
PI (pH):   %s   5.04 (4.91) Peptide Signal:   %s   cut: 25 range:25-395
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKNLGVIGVVYGLMALATLQVASAWCPFAGRRSLLQAAAPAPLPARPTGPDPSNWTMLNYDFYTAGLPENACPSFQNIVKKEVAKATVLDSLTPAFLLRLFFHDCFVMGCDASVLINSTLLNLAEKDQTKSFSLNKFNVVDDIKTALEVACPGVVSCADILAAAAVECVEQSGGPHIDLAYGRRDGLESFAAAAATYMPGGFLRVQGLIESFQMAGLDEVDLVALSGAHTLGQARCSEFIQERFISPGSNSFRDSDYGLALQSYCAEGKNLGLDRKVTLDSNTSTIFDNGYFQTLVDGRGVLTSDNDLTLDNRTAPLVQLYASDQNAFFTAFAASMRKMSKIGILTGTQGQVRKKCYVRNSVDVVKSPNSNTEFSPISPTICKPAPQVDQKCDG

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 2 and 3) and 8 ESTs. ecotype="Gransden 2004". Incorrect prediction from Phytozome (shorter PS).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAATCTCGGAGTCATTGGTGTAGTATATGGCCTGATGGCGTTGGCAACTCTCCAAGTCGCAAGCGCTTGGTGTCCATTTGCCGGGAGGCGTAGCTTGCTTCAAGCAGCAGCTCCG
GCACCTCTACCCGCGCGTCCTACTGGACCAGACCCTTCCAACTGGACAATGTTGAATTACGATTTCTACACGGCCGGGCTTCCAGAAAATGCATGTCCCAGTTTTCAGAATATTGTAAAG
AAAGAAGTGGCTAAAGCCACAGTATTGGATTCACTCACTCCGGCATTTTTGCTTCGTTTGTTCTTCCACGACTGCTTCGTAATGGGATGTGACGCATCTGTTCTTATCAACTCGACTCTC
CTCAATTTAGCAGAGAAGGATCAAACCAAAAGTTTTTCCCTAAACAAGTTTAATGTTGTCGACGACATCAAGACCGCCTTGGAGGTTGCGTGTCCTGGTGTAGTGTCATGTGCTGATATT
TTGGCTGCCGCAGCTGTGGAATGTGTAGAACAG
GTATTCTTCACTCCTCTATGTGGCCAGTGCGCAGTTGGGTCTGGGTCCAATTTTTATTTTCTTTCCGTAGTTGCATATCTTGAAACG
CTTACCGTGCATTGATGGTCTTCATCTCTGGATTGTCCTGGAACAGTCGGGAGGGCCTCACATTGATTTGGCGTACGGCCGACGAGATGGTCTGGAATCCTTCGCGGCCGCTGCGGCGAC
CTATATGCCAGGGGGGTTTCTTCGCGTGCAAGGGCTCATTGAAAGTTTCCAGATGGCCGGATTGGATGAAGTCGATTTGGTTGCTTTATCAG
GTTCACTCTCAATACTAGCCCTATCGAA
ATCTGTCATTACTTCACATCTTACACACTCAGTGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATGTGCCAATCGTAACTTGTGCGACGCTTTAACT
CTTCACAGGAGCCCACACCCTCGGCCAGGCCCGCTGTTCAGAATTCATTCAAGAAAGATTCATATCCCCAGGAAGCAACAGCTTCAGAGACTCTGATTACGGCCTAGCTTTGCAATCGTA
TTGCGCAGAGGGAAAAAATTTGGGGTTGGACCGCAAAGTGACGCTTGATTCGAACACCTCCACCATTTTTGACAACGGCTACTTTCAGACCTTAGTCGATGGTCGTGGCGTCTTGACATC
GGACAATGATTTGACACTCGACAATCGTACCGCACCGCTCGTGCAACTTTACGCTAGTGATCAGAATGCGTTCTTCACCGCTTTCGCAGCGTCAATGAGAAAGATGAGCAAGATTGGCAT
TCTGACAGGCACACAGGGCCAAGTTCGGAAGAAGTGCTATGTCCGCAACAGCGTTGACGTAGTCAAAAGCCCTAACAGCAACACCGAGTTTAGTCCCATCTCTCCCACTATATGTAAGCC
TGCACCCCAGGTCGACCAGAAGTGCGACGGTACG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAATCTCGGAGTCATTGGTGTAGTATATGGCCTGATGGCGTTGGCAACTCTCCAAGTCGCAAGCGCTTGGTGTCCATTTGCCGGGAGGCGTAGCTTGCTTCAAGCAGCAGCTCCG
GCACCTCTACCCGCGCGTCCTACTGGACCAGACCCTTCCAACTGGACAATGTTGAATTACGATTTCTACACGGCCGGGCTTCCAGAAAATGCATGTCCCAGTTTTCAGAATATTGTAAAG
AAAGAAGTGGCTAAAGCCACAGTATTGGATTCACTCACTCCGGCATTTTTGCTTCGTTTGTTCTTCCACGACTGCTTCGTAATGGGATGTGACGCATCTGTTCTTATCAACTCGACTCTC
CTCAATTTAGCAGAGAAGGATCAAACCAAAAGTTTTTCCCTAAACAAGTTTAATGTTGTCGACGACATCAAGACCGCCTTGGAGGTTGCGTGTCCTGGTGTAGTGTCATGTGCTGATATT
TTGGCTGCCGCAGCTGTGGAATGTGTAGAACAG
TCGGGAGGGCCTCACATTGATTTGGCGTACGGCCGACGAGATGGTCTGGAATCCTTCGCGGCCGCTGCGGCGACCTATATGCCAGGG
GGGTTTCTTCGCGTGCAAGGGCTCATTGAAAGTTTCCAGATGGCCGGATTGGATGAAGTCGATTTGGTTGCTTTATCAG
GAGCCCACACCCTCGGCCAGGCCCGCTGTTCAGAATTCATT
CAAGAAAGATTCATATCCCCAGGAAGCAACAGCTTCAGAGACTCTGATTACGGCCTAGCTTTGCAATCGTATTGCGCAGAGGGAAAAAATTTGGGGTTGGACCGCAAAGTGACGCTTGAT
TCGAACACCTCCACCATTTTTGACAACGGCTACTTTCAGACCTTAGTCGATGGTCGTGGCGTCTTGACATCGGACAATGATTTGACACTCGACAATCGTACCGCACCGCTCGTGCAACTT
TACGCTAGTGATCAGAATGCGTTCTTCACCGCTTTCGCAGCGTCAATGAGAAAGATGAGCAAGATTGGCATTCTGACAGGCACACAGGGCCAAGTTCGGAAGAAGTGCTATGTCCGCAAC
AGCGTTGACGTAGTCAAAAGCCCTAACAGCAACACCGAGTTTAGTCCCATCTCTCCCACTATATGTAAGCCTGCACCCCAGGTCGACCAGAAGTGCGACGGTACG

Retrieve as FASTA