Entry information : PpaPrx27 (PP00354G00130)
Entry ID 3438
Creation 2008-08-06 (Christophe Dunand)
Last sequence changes 2010-06-08 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: PpaPrx27 (PP00354G00130)
Name (synonym) PpaPrx27 (PP00354G00130)
Class Class III peroxidase     [Orthogroup: Prx142]*
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation Apoplastic
Tissue type Protonema
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx27
start..stop
S start..stop
SpolPrx05 273 7e-91 18..339 8..325
PatrPrx10 271 5e-90 10..340 1..329
PtPrx89 271 8e-90 10..340 2..329
PpaPrx08 270 2e-89 36..339 30..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 270414..270683 270 N° 2 269804..270149 346 N° 3 269159..269577 419  
complement(join(269159..269577,269804..270149,270414..270683))


exon

Literature and cross-references PpaPrx27 (PP00354G00130)
Literature Rensing,S. et al., The genome of the moss Physcomitrella patens reveals evolutionary insights into the conquest of land by plants. Science (2008).
DNA ref. Phytozome 11:   scaffold_354 (270683..269159)
EST ref. GenBank:   FC341398.1 [5' end]
Protein sequence: PpaPrx27 (PP00354G00130)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   344
PWM (Da):   %s   37695.09 Transmb domain:   %s   i9-31o
PI (pH):   %s   8.4
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARIHRDVSVLGSMALVALCLYCGVAGAVLNYTPGLRYDFYKNSCPRADDIVFEQMTEIFKTKPTAQDGDFGKNVAPDLLRLHFHDCFVRGCEGSVLMDKPGSEKTAPPNGRLEGFDAVDKIKAALEGECPGTVSCADLLAFAARDGVRLTGGFFYRVPAGRRDGYDSIAAEATKNLPDPRMNVDQLTLNFKNQGLTRDEMVILSGAHTIGDVACHHIDNRLYTYPGNNGVVPSLPRAFVKKLKGICPRPNLFDITVDMDQVTPIRFDSQYYKNLASKTSVLSSDQVLYDDVRTRPLVRVLESKLAFLSKFGPAMVRMGNINVLTGNQGEVRLNCRRKNSPGSA

Retrieve as FASTA  
Remarks complete sequence from genomic (introns 1 and 3) and 1 EST. Strain="Villersexel 2003" and ecotype="Gransden 2004".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAGAATTCATCGAGATGTATCCGTTCTTGGGTCGATGGCGCTAGTTGCTTTGTGCTTGTATTGTGGCGTCGCTGGCGCAGTTCTCAATTACACGCCTGGCTTACGATACGATTTC
TACAAGAACAGCTGCCCACGAGCGGACGACATAGTCTTCGAACAGATGACGGAGATTTTCAAAACAAAGCCCACCGCTCAGGATGGTGATTTCGGCAAGAATGTGGCTCCTGACCTCCTC
CGGCTTCATTTCCATGACTGTTTCGTCCGT
GTAAGTCATCAATCTCACACCGCGTGAACGAGAAAGTGTGCACCGCCACCCTTGCATTGCAAGTTTCGCCTTCCGGAATCCAGGCGCCTT
CGTTCGCATCCTGGTTTCCAACTTACTCCCTTCAGCTGTTCCCATAGCGGCGGATCTTGTGTTGTTTTACTGTGAAGCGTCAGCGTCGCACCCTCAAAAGGTTTGTTTGAATGCATGTGT
TTGACCATCGTACTGATGATGAGTGTGAAACGTGGTTCTTGAATGCCACTCCAGGGTTGCGAAGGTTCAGTTCTTATGGACAAGCCCGGATCGGAGAAGACCGCACCTCCCAATGGTCGC
CTGGAAGGATTCGACGCCGTGGATAAAATCAAGGCTGCGCTTGAGGGGGAATGCCCGGGGACTGTCTCCTGCGCCGACCTGCTGGCATTTGCGGCCCGGGACGGTGTGAGACTGACCGGA
GGATTTTTCTACAGGGTGCCCGCCGGACGCAGAGACGGATACGATTCCATAGCAGCCGAGGCGACGAAGAACCTGCCCGACCCACGGATGAACGTCGACCAGCTGACCCTTAACTTCAAG
AATCAGGGACTGACAAGAGATGAGATGGTCATCCTTTCAG
GTAAACGACGATGCGACAATCCCTTGACTCCTCACCACTCGCATCTTGTTGTACCTCCACATCTACGCTTGCATTCCAAT
GCTGGCAATCTCGAGAGGATGCAGCGATCAGAGTGATGTTGCCTGAGCAACTGATGCAACGAGTGGCAATCCGGCGGCATTCGTCGTGATTACAGCGAGATCAGAGTCTCATTAGAACGA
TGTCTGATGTGGACCCTTGATTGCAGGTGCTCACACTATTGGCGACGTCGCATGCCACCACATCGACAACAGGCTGTACACTTACCCCGGAAACAATGGGGTCGTCCCAAGCCTTCCGAG
GGCGTTCGTCAAAAAGCTGAAGGGTATCTGCCCGCGGCCGAATCTGTTCGATATCACCGTAGACATGGATCAGGTCACTCCGATCAGATTCGACTCGCAATACTACAAGAACCTAGCGAG
CAAGACGTCCGTGCTGTCGTCGGATCAGGTTCTGTACGATGATGTAAGAACTCGGCCCCTAGTGAGGGTTCTGGAGAGCAAGTTAGCATTCTTGAGCAAGTTCGGACCAGCGATGGTGCG
GATGGGCAACATCAATGTGCTAACCGGAAACCAAGGCGAGGTTCGTCTGAACTGCCGACGAAAGAACTCTCCGGGGTCAGCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAGAATTCATCGAGATGTATCCGTTCTTGGGTCGATGGCGCTAGTTGCTTTGTGCTTGTATTGTGGCGTCGCTGGCGCAGTTCTCAATTACACGCCTGGCTTACGATACGATTTC
TACAAGAACAGCTGCCCACGAGCGGACGACATAGTCTTCGAACAGATGACGGAGATTTTCAAAACAAAGCCCACCGCTCAGGATGGTGATTTCGGCAAGAATGTGGCTCCTGACCTCCTC
CGGCTTCATTTCCATGACTGTTTCGTCCGT
GGTTGCGAAGGTTCAGTTCTTATGGACAAGCCCGGATCGGAGAAGACCGCACCTCCCAATGGTCGCCTGGAAGGATTCGACGCCGTGGAT
AAAATCAAGGCTGCGCTTGAGGGGGAATGCCCGGGGACTGTCTCCTGCGCCGACCTGCTGGCATTTGCGGCCCGGGACGGTGTGAGACTGACCGGAGGATTTTTCTACAGGGTGCCCGCC
GGACGCAGAGACGGATACGATTCCATAGCAGCCGAGGCGACGAAGAACCTGCCCGACCCACGGATGAACGTCGACCAGCTGACCCTTAACTTCAAGAATCAGGGACTGACAAGAGATGAG
ATGGTCATCCTTTCAG
GTGCTCACACTATTGGCGACGTCGCATGCCACCACATCGACAACAGGCTGTACACTTACCCCGGAAACAATGGGGTCGTCCCAAGCCTTCCGAGGGCGTTCGTC
AAAAAGCTGAAGGGTATCTGCCCGCGGCCGAATCTGTTCGATATCACCGTAGACATGGATCAGGTCACTCCGATCAGATTCGACTCGCAATACTACAAGAACCTAGCGAGCAAGACGTCC
GTGCTGTCGTCGGATCAGGTTCTGTACGATGATGTAAGAACTCGGCCCCTAGTGAGGGTTCTGGAGAGCAAGTTAGCATTCTTGAGCAAGTTCGGACCAGCGATGGTGCGGATGGGCAAC
ATCAATGTGCTAACCGGAAACCAAGGCGAGGTTCGTCTGAACTGCCGACGAAAGAACTCTCCGGGGTCAGCGTGA

Retrieve as FASTA