Entry information : PpaPrx30 (PP00016G00810)
Entry ID 3441
Creation 2008-08-06 (Christophe Dunand)
Last sequence changes 2008-08-06 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: PpaPrx30 (PP00016G00810)
Name (synonym) PpaPrx30 (PP00016G00810)
Class Class III peroxidase    [Orthogroup: Prx178]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx30
start..stop
S start..stop
PpaPrx20 509 0 28..319 23..314
PpaPrx21 480 9e-173 1..317 1..317
PpaPrx12 470 1e-168 1..319 1..320
PpaPrx34 290 5e-98 26..318 20..314
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1285201..1285428 228 N° 2 1284151..1284499 349 N° 3 1283609..1283991 383  
complement(join(1283609..1283991,1284151..1284499,1285201..1285428))


exon

Literature and cross-references PpaPrx30 (PP00016G00810)
Literature REFERENCE 1 Kuroki,Y., Toyoda,A., Sakaki,Y., Tanahashi,T., Nishiyama,T., Hiwatashi,Y., Suzuki,Y., Sugano,S., Fujiyama,A. and Hasebe,M. Evolution of developmental genes in land plants. Unpublished (2006).
REFERENCE 2 Rensing,S. et al., The genome of the moss Physcomitrella patens reveals evolutionary insights into the conquest of land by plants. Science (2008).
DNA ref. Phytozome 12:   scaffold_16 (1285428..1283609)
EST ref. GenBank:   BY956139 [5' end]
Protein sequence: PpaPrx30 (PP00016G00810)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (292)
PWM (Da):   %s   33767.87 (30916.2)  
PI (pH):   %s   5.09 (4.89) Peptide Signal:   %s   cut: 28 range:28-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGIWTAFKTLAAALLLVAMILKPVVEAQLQYGYYETLGCRGVENLVRTSVGLSFLTDPTASAAMLRLAFHDCQVGPGGCDGSIMVEGNGREMDAGGNFGVKRLDIINSVKADLERMCPMTVSCADIIAMVGRDAVAFSGGPEIQIPLGRKDADFSSASEADAKLPPSTSSVDTILSVFAPFGMSLAESVASLGAHTLGGGHCKNIQDRLRFNSPTAPTSLLYRTQLRAACVVNVFDIAILNNDASQFTFDNQYFKDIQNGRGLFTVDNLLSTDPRTAPIVSLYATNEAALFAAFQSAYVTLTSRAMTGTQGSVRSTCHL

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 3) and 1 EST. Ecotype="Gransden 2004", Strain="Gransden2004". Incorrect prediction from Phytozome (shorter PS).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGATTTGGACGGCATTCAAGACTCTTGCCGCGGCTTTGCTGCTGGTAGCTATGATACTGAAGCCGGTTGTGGAAGCTCAGCTGCAGTATGGATACTATGAGACCTTGGGGTGTCGT
GGGGTGGAGAATCTAGTGCGAACATCAGTGGGGCTTAGTTTCCTGACGGACCCTACAGCAAGCGCTGCAATGCTGCGTCTTGCTTTCCATGACTGTCAAGTTGGACCG
GTACGTACTTCA
AAACTAGACAGTGCAATGGCATTGGATCAAAGCTTGTGCTTATGTTCCTCTGGAGGTCCTTGAGCTTGTCTTTTGTACATCGAAACCCCCGGCATTACTAATTAAAAGCTCTAGTTCATG
TCGTGACGACTTCGATGTGTCGTGGAAACTATCCAAAAGGTCGTTTCCGTTTGTGACTTATGTTGTTCACCAATGTACGAGAATCAATAACGCTGTTTTCCCCTGCTGCTTGACTTCTCC
GCAAACGCACAAATGATGTCCAGCTTACTATGACGGTGCACCTCACCATTTGCTCCTCGTGTTGTTAAGCGAGAGCCTAGTATTAATGTTGTAGCTATTTGAGGCCGGAATTGGGCATTT
AATATGTGAGAGCATTTGAATGAAATTTATATAGCTCGCTTAAATTGTTTTAGAATAGCAGATTCCAAAAACATGAGTAAGCATTAGGAGATTCTTTTCCTTGCAGAGGATTAGTGTTGG
GAAGCTTGTGCAAGTAATGGCAAATAAACTTAAGCCTGCCGACTCCAGTAGAAGTTTGATTAGACCAATTTTAAACTATATTGAGCTAATCGAGGTACGTATTGTATGTCTAGCCGTAGT
GCTTCATTGCTTTCCAATAATTGCCTCCATGTTTGATCGGTGGGTACTGGTCCCAGTTCGACATCTTGAAGGAATTGCTCATTGTGCAGGGAGGGTGTGATGGCTCTATAATGGTAGAGG
GCAATGGCAGAGAGATGGACGCTGGCGGCAACTTTGGCGTAAAGCGCCTGGACATTATCAACTCCGTGAAAGCCGATTTAGAGAGGATGTGTCCTATGACGGTTTCCTGCGCGGACATTA
TCGCCATGGTCGGACGGGATGCAGTTGCCTTCAGTGGTGGCCCTGAAATTCAAATACCTCTCGGGAGAAAGGATGCAGATTTCTCCAGCGCATCTGAGGCCGATGCTAAACTCCCGCCCT
CCACCTCCAGTGTGGACACAATCCTTAGTGTCTTCGCTCCCTTTGGCATGAGCTTGGCAGAAAGTGTTGCCAGCTTAG
GTACAGAACCGGATTGAAAGTTGAANNNNNNNNNNNNNNNNN
NNNNNNAAATCACGTATGATTTTGAATAACAAGTCTGTCACGATGCAATAGTTTAATCCAGGAATTCTGACGAACAATATCGTTCACTTAACTTCCGCAAATTCCATTTCTGTGCAGGAG
CACACACTCTCGGAGGAGGCCATTGCAAAAACATCCAAGATCGTCTGCGATTCAACAGTCCAACTGCCCCTACCAGCCTCCTCTACCGCACGCAATTGCGGGCGGCATGCGTAGTGAACG
TGTTCGACATCGCAATCCTCAACAACGACGCGTCTCAGTTCACATTCGACAACCAGTATTTTAAAGACATTCAGAATGGACGAGGCCTCTTCACCGTCGACAACCTGCTCAGCACAGATC
CACGGACAGCGCCCATCGTGTCGCTGTACGCGACCAACGAGGCTGCCCTCTTCGCCGCTTTTCAGTCGGCGTACGTGACACTGACCTCACGAGCCATGACGGGAACACAAGGCAGCGTGA
GGAGCACCTGCCATCTCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGATTTGGACGGCATTCAAGACTCTTGCCGCGGCTTTGCTGCTGGTAGCTATGATACTGAAGCCGGTTGTGGAAGCTCAGCTGCAGTATGGATACTATGAGACCTTGGGGTGTCGT
GGGGTGGAGAATCTAGTGCGAACATCAGTGGGGCTTAGTTTCCTGACGGACCCTACAGCAAGCGCTGCAATGCTGCGTCTTGCTTTCCATGACTGTCAAGTTGGACCG
GGAGGGTGTGAT
GGCTCTATAATGGTAGAGGGCAATGGCAGAGAGATGGACGCTGGCGGCAACTTTGGCGTAAAGCGCCTGGACATTATCAACTCCGTGAAAGCCGATTTAGAGAGGATGTGTCCTATGACG
GTTTCCTGCGCGGACATTATCGCCATGGTCGGACGGGATGCAGTTGCCTTCAGTGGTGGCCCTGAAATTCAAATACCTCTCGGGAGAAAGGATGCAGATTTCTCCAGCGCATCTGAGGCC
GATGCTAAACTCCCGCCCTCCACCTCCAGTGTGGACACAATCCTTAGTGTCTTCGCTCCCTTTGGCATGAGCTTGGCAGAAAGTGTTGCCAGCTTAG
GAGCACACACTCTCGGAGGAGGC
CATTGCAAAAACATCCAAGATCGTCTGCGATTCAACAGTCCAACTGCCCCTACCAGCCTCCTCTACCGCACGCAATTGCGGGCGGCATGCGTAGTGAACGTGTTCGACATCGCAATCCTC
AACAACGACGCGTCTCAGTTCACATTCGACAACCAGTATTTTAAAGACATTCAGAATGGACGAGGCCTCTTCACCGTCGACAACCTGCTCAGCACAGATCCACGGACAGCGCCCATCGTG
TCGCTGTACGCGACCAACGAGGCTGCCCTCTTCGCCGCTTTTCAGTCGGCGTACGTGACACTGACCTCACGAGCCATGACGGGAACACAAGGCAGCGTGAGGAGCACCTGCCATCTCTAG

Retrieve as FASTA