Entry information : PpaPrx31 (Phpat.010G064700 / Pp1s381_53V6)
Entry ID 3442
Creation 2008-08-06 (Christophe Dunand)
Last sequence changes 2014-01-16 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: PpaPrx31 (Phpat.010G064700 / Pp1s381_53V6)
Name (synonym) PpaPrx31 (Phpat.010G064700 / Pp1s381_53V6)
Class Class III peroxidase    [Orthogroup: Prx051]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation Apoplastic
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx31
start..stop
S start..stop
PpaPrx29 478 8e-172 1..325 1..321
PpaPrx51 456 6e-163 1..326 1..320
PpaPrx55 451 5e-161 1..326 1..320
PpaPrx14 310 2e-105 28..326 39..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11375502..11375744 243 N° 2 11375162..11375341 180 N° 3 11374401..11374958 558  
complement(join(11374401..11374958,11375162..11375341,11375502..11375744))


exon

Literature and cross-references PpaPrx31 (Phpat.010G064700 / Pp1s381_53V6)
Literature Rensing,S. et al., The genome of the moss Physcomitrella patens reveals evolutionary insights into the conquest of land by plants. Science (2008).
DNA ref. Phytozome 12:   scaffold_381 (342401..343743)
Protein sequence: PpaPrx31 (Phpat.010G064700 / Pp1s381_53V6)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327
PWM (Da):   %s   35174.14 Transmb domain:   %s   i7-29o
PI (pH):   %s   8.11
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRWASTGFLAIFITIAIAIAIVMNLIIPAGAHKGLEVGFYRNSCPEVETIVYKSMAQSYKTNMTVAPGVLRLAFHDCFVRGCDAFVLLDGPNTERKSVLNGGLHGYDAVDAAKRATEKACPGIVSAPDVLQFAARDSVILTGGYRWSVPAGRLDGTISLITEATDVNLDLPNMTLSQLVARFREKGLSALxMVVLSGFHTIGKAPCLTFDDRVQTNPVDPTLAPSFAASLKKQCLYAQITSTKVALDSTPRRFDTQYFKDIIQGRGVLISDQELLYDSRTVGVVRANKGSAFYRNFGEAMVAMSELGVLTDGSGEIRRQIDQVNT*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). no EST. Frame shift just before VALS. Incorrect prediction from Phytozome (PS is missing and extra intron due to the frame shift). Missing 'c'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGAGGTGGGCCTCAACGGGCTTCCTGGCGATCTTCATCACGATCGCCATCGCCATCGCCATCGTCATGAATTTAATCATCCCAGCAGGAGCTCACAAGGGACTGGAGGTCGGGTTC
TATCGTAACAGCTGTCCCGAAGTCGAGACCATCGTGTACAAGTCCATGGCTCAATCCTATAAGACAAACATGACCGTTGCACCCGGAGTTCTTCGGCTGGCGTTCCACGACTGCTTCGTG
CGG
GTGAGAGATCGTCGTGCTTTGTAGTGCCCCAGCCAGCTAGAACGACTCGCACGCACTTGAGCTGAGAAGCAACGGGTTTGTGATTGCAGTGTTCCCGAGTGATCTTCTATACATGTC
TCATACTGTGACTAAATCATCTTCGTGTGTGGGGCTGCTTCAGGGTTGCGACGCTTTCGTGCTGCTAGATGGACCGAACACAGAGCGAAAGTCGGTATTGAATGGCGGACTCCATGGCTA
TGATGCCGTCGACGCCGCAAAAAGGGCTACGGAGAAGGCTTGCCCAGGCATAGTCTCAGCCCCGGATGTGTTGCAGTTCGCCGCCCGTGACTCAGTTATACTG
GCAAGCTATCCTCCTGA
CTTGTGGATGTGAAGGTGGCAGTGCGTGTGGATCCATGTTCCGTCGCTGCTCGGATGTCGATCCCCACCTTGGCCTGATCGCACACGAGTCGCATTGAACGATCCCGGAGCACATCACAT
CCCATACTGTGCGGTTGATTATCAGGCTCTCGTTTCTGACCTGTGGATCGCGCCTTGCGTCTCCAGACTGGAGGCTACCGATGGAGCGTGCCCGCTGGGCGTCTAGACGGGACGATTTCC
CTCATCACGGAGGCAACGGATGTGAACCTAGACCTTCCGAACATGACCCTGTCTCAACTCGTAGCAAGGTTCCGGGAGAAGGGCTTGAGCGCTCTCNTAATGGTAGTCCTGTCAGGTTTC
CACACCATCGGAAAAGCTCCATGCCTTACATTCGACGACCGCGTTCAGACGAACCCGGTAGACCCAACTCTAGCTCCCAGCTTCGCGGCGTCCTTGAAGAAGCAGTGCCTGTATGCACAG
ATCACTTCGACCAAAGTGGCCCTGGATTCCACCCCGCGGAGATTCGACACCCAGTACTTCAAGGACATCATCCAAGGAAGAGGCGTGTTGATCTCGGACCAGGAACTGCTGTATGACTCG
CGCACCGTAGGGGTGGTGCGCGCCAACAAGGGCAGTGCGTTTTACCGAAACTTCGGCGAGGCGATGGTGGCGATGAGCGAGCTCGGGGTGCTCACAGATGGTTCCGGCGAAATTCGCAGA
CAGATCGACCAAGTGAACACGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGAGGTGGGCCTCAACGGGCTTCCTGGCGATCTTCATCACGATCGCCATCGCCATCGCCATCGTCATGAATTTAATCATCCCAGCAGGAGCTCACAAGGGACTGGAGGTCGGGTTC
TATCGTAACAGCTGTCCCGAAGTCGAGACCATCGTGTACAAGTCCATGGCTCAATCCTATAAGACAAACATGACCGTTGCACCCGGAGTTCTTCGGCTGGCGTTCCACGACTGCTTCGTG
CGG
GGTTGCGACGCTTTCGTGCTGCTAGATGGACCGAACACAGAGCGAAAGTCGGTATTGAATGGCGGACTCCATGGCTATGATGCCGTCGACGCCGCAAAAAGGGCTACGGAGAAGGCT
TGCCCAGGCATAGTCTCAGCCCCGGATGTGTTGCAGTTCGCCGCCCGTGACTCAGTTATACTG
ACTGGAGGCTACCGATGGAGCGTGCCCGCTGGGCGTCTAGACGGGACGATTTCCCTC
ATCACGGAGGCAACGGATGTGAACCTAGACCTTCCGAACATGACCCTGTCTCAACTCGTAGCAAGGTTCCGGGAGAAGGGCTTGAGCGCTCTCNTAATGGTAGTCCTGTCAGGTTTCCAC
ACCATCGGAAAAGCTCCATGCCTTACATTCGACGACCGCGTTCAGACGAACCCGGTAGACCCAACTCTAGCTCCCAGCTTCGCGGCGTCCTTGAAGAAGCAGTGCCTGTATGCACAGATC
ACTTCGACCAAAGTGGCCCTGGATTCCACCCCGCGGAGATTCGACACCCAGTACTTCAAGGACATCATCCAAGGAAGAGGCGTGTTGATCTCGGACCAGGAACTGCTGTATGACTCGCGC
ACCGTAGGGGTGGTGCGCGCCAACAAGGGCAGTGCGTTTTACCGAAACTTCGGCGAGGCGATGGTGGCGATGAGCGAGCTCGGGGTGCTCACAGATGGTTCCGGCGAAATTCGCAGACAG
ATCGACCAAGTGAACACGTAG

Retrieve as FASTA