Entry information : PpaPrx32 (PP00178G00270)
Entry ID 3443
Creation 2008-08-05 (Christophe Dunand)
Last sequence changes 2011-01-26 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: PpaPrx32 (PP00178G00270)
Name (synonym) PpaPrx32 (PP00178G00270)
Class Class III peroxidase    [Orthogroup: Prx094]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx32
start..stop
S start..stop
PpaPrx23 560 0 5..335 8..338
PpaPrx41 303 3e-101 38..343 63..364
PpaPrx15 302 6e-101 37..343 71..374
PpaPrx37 291 3e-97 43..343 40..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 282434..282892 459 N° 2 282145..282310 166 N° 3 281638..282047 410  
complement(join(281638..282047,282145..282310,282434..282892))


exon

Literature and cross-references PpaPrx32 (PP00178G00270)
Literature Quatrano,R.,Bashiardes,S., Cove,D., Cuming,A., Knight,C., Clifton ,S., Marra,M., Hillier,L., Pape,D., Martin,J., Wylie,T., Underwood ,K., Theising,B., Allen,M., Bowers,Y., Person,B., Swaller,T., Steptoe,M., Gibbons,M., Harvey,N., Ritter,E., Jackson,Y., McCann,R., Waterston,R. and Wilson,R. Leeds/Wash U Moss EST Project.
DNA ref. Phytozome 12:   scaffold_178 (282892..281638)
Cluster/Prediction ref. UniGene:   Ppa.16962 [3' end]
Protein sequence: PpaPrx32 (PP00178G00270)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   344 (322)
PWM (Da):   %s   37292.09 (35006.9)  
PI (pH):   %s   5.37 (5.71) Peptide Signal:   %s   cut: 23 range:23-344
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSILQTLALLLCLAVSFQPGDARCPLAILGRRSLKQADLPPQPPLQFGFYDISCPSLNAIIDERMRFWVLQDIRTPAKILRLFFHDCFAAGCEASILLNSTSTVLAEKDAPISQTLDKYDVIENIKWTVETACPGIVSCADILALAAAKSVELAGGPILQTETGRRDGVVSYLAGATASMPLSIQKIDDLLAMFVQAGLDLTDLVILSGAHTIGEVHCTNFADRFDPAANSPFPDPSFGEQLRAYCTRGGTGDMATLNLRTFIDLQSPNSFDISYFVNLIVGRGVMTSDQALFNDQRTQPLVRAFAGNRTLFFESFQASMLKMGRLHVLTGTSGVIRRQCGVRA

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 2 and 3) and 3 ESTs. Incorrect prediction from Phytozome (splicing error in 5').
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCATTCTGCAAACGCTGGCACTGTTGCTTTGTCTAGCGGTGTCATTCCAACCAGGAGACGCAAGATGTCCGTTGGCAATCCTGGGCAGGCGCTCATTGAAGCAAGCAGATCTTCCG
CCCCAGCCACCCTTGCAATTTGGATTCTACGACATATCTTGCCCGTCGCTTAATGCCATCATCGACGAGAGAATGCGCTTCTGGGTTCTGCAGGACATCCGGACCCCCGCGAAGATATTG
AGGCTCTTTTTTCACGACTGCTTTGCGGCTGGGTGCGAGGCATCAATCCTGCTGAACTCTACTTCAACAGTCTTAGCGGAGAAGGATGCACCAATTTCCCAGACTCTGGACAAGTATGAT
GTGATCGAGAATATCAAATGGACAGTAGAGACGGCTTGCCCTGGGATTGTTTCCTGCGCTGATATTCTCGCACTCGCGGCTGCCAAGTCCGTTGAGCTA
GTAATTGCCGCAACCACCATC
CGTTTATGAACTTGCTTCACAACCATTGAGTTCCGGTTCGTTAGGTTGGATGAGCAGCATTGAACATAATTTCCCCGGTTGTCGATTTTGAATCATTCGCAGGCTGGGGGGCCGATTCTT
CAAACAGAAACAGGACGACGAGATGGCGTAGTCTCGTATCTTGCTGGTGCGACTGCGAGCATGCCTCTGTCCATCCAGAAGATCGATGACTTACTTGCAATGTTCGTGCAGGCGGGCCTG
GACTTAACTGATCTTGTGATCCTTTCAG
GTAGGCTTTGTGCATCACCTGATTATCTTCAATTTCCCTTTCCGAGTTGCGAAACAAAAGCGTGAGCGAACCTCACACGAAAGTGGCATCGG
TTCAGGTGCTCACACAATTGGGGAAGTTCATTGCACCAACTTTGCCGACCGTTTCGACCCAGCGGCGAATAGTCCTTTTCCGGACCCATCTTTCGGGGAGCAACTGCGCGCATACTGCAC
TCGCGGCGGCACAGGCGATATGGCAACCCTGAACCTGAGGACTTTTATAGACTTGCAGTCGCCCAACAGCTTTGACATCTCATATTTCGTGAATCTGATCGTAGGCCGCGGCGTCATGAC
CTCAGACCAAGCCCTGTTCAATGATCAGCGTACGCAACCCCTTGTGAGAGCATTTGCCGGCAATCGAACTCTATTCTTCGAGAGTTTCCAGGCGTCCATGCTCAAGATGGGTCGGCTTCA
CGTGCTCACTGGGACGAGCGGCGTAATCCGGAGGCAATGTGGGGTACGTGCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCATTCTGCAAACGCTGGCACTGTTGCTTTGTCTAGCGGTGTCATTCCAACCAGGAGACGCAAGATGTCCGTTGGCAATCCTGGGCAGGCGCTCATTGAAGCAAGCAGATCTTCCG
CCCCAGCCACCCTTGCAATTTGGATTCTACGACATATCTTGCCCGTCGCTTAATGCCATCATCGACGAGAGAATGCGCTTCTGGGTTCTGCAGGACATCCGGACCCCCGCGAAGATATTG
AGGCTCTTTTTTCACGACTGCTTTGCGGCTGGGTGCGAGGCATCAATCCTGCTGAACTCTACTTCAACAGTCTTAGCGGAGAAGGATGCACCAATTTCCCAGACTCTGGACAAGTATGAT
GTGATCGAGAATATCAAATGGACAGTAGAGACGGCTTGCCCTGGGATTGTTTCCTGCGCTGATATTCTCGCACTCGCGGCTGCCAAGTCCGTTGAGCTA
GCTGGGGGGCCGATTCTTCAA
ACAGAAACAGGACGACGAGATGGCGTAGTCTCGTATCTTGCTGGTGCGACTGCGAGCATGCCTCTGTCCATCCAGAAGATCGATGACTTACTTGCAATGTTCGTGCAGGCGGGCCTGGAC
TTAACTGATCTTGTGATCCTTTCAG
GTGCTCACACAATTGGGGAAGTTCATTGCACCAACTTTGCCGACCGTTTCGACCCAGCGGCGAATAGTCCTTTTCCGGACCCATCTTTCGGGGAG
CAACTGCGCGCATACTGCACTCGCGGCGGCACAGGCGATATGGCAACCCTGAACCTGAGGACTTTTATAGACTTGCAGTCGCCCAACAGCTTTGACATCTCATATTTCGTGAATCTGATC
GTAGGCCGCGGCGTCATGACCTCAGACCAAGCCCTGTTCAATGATCAGCGTACGCAACCCCTTGTGAGAGCATTTGCCGGCAATCGAACTCTATTCTTCGAGAGTTTCCAGGCGTCCATG
CTCAAGATGGGTCGGCTTCACGTGCTCACTGGGACGAGCGGCGTAATCCGGAGGCAATGTGGGGTACGTGCATGA

Retrieve as FASTA