Entry information : MtPrx24 (Medtr4g029200.1 [4.0])
Entry ID 350
Creation 2005-09-13 (Christophe Dunand)
Last sequence changes 2014-07-16 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-07-16 (Christophe Dunand)
Peroxidase information: MtPrx24 (Medtr4g029200.1 [4.0])
Name (synonym) MtPrx24 (Medtr4g029200.1 [4.0])
Class Class III peroxidase    [Orthogroup: Prx168]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Germinating seeds
Immature seeds
Roots nodules
Seedling roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx24
start..stop
S start..stop
MtPrx32 529 0 1..338 1..340
GmPrx135 423 8e-150 10..338 9..330
GmPrx52 421 4e-149 3..338 2..316
GmPrx188 419 2e-148 3..338 2..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10084351..10084623 273 N° 2 10084078..10084269 192 N° 3 10083612..10083777 166 N° 4 10082881..10083266 386
complement(join(10082881..10083266,10083612..10083777,10084078..10084269,1008435 1..10084623))


exon

Literature and cross-references MtPrx24 (Medtr4g029200.1 [4.0])
Literature Grusak,M.A. et al., unpublished
DNA ref. Phytozome 11:   chr4 (10084623..10082881)
Cluster/Prediction ref. Phytozome Gene 11:   31111464
Omic ref. Gene atlas:   Mtr.10375.1.S1_at Legoo:   Mtr.10375.1.S1_at
Protein sequence: MtPrx24 (Medtr4g029200.1 [4.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338 (315)
PWM (Da):   %s   36917.88 (34529.6) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.58 (9.78) Peptide Signal:   %s   cut: 24 range:24-338
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAIVTHSSVIFCVMICLIGIVSASNVIPSATTLVSSLIPTPNYSELSSTFYGTRCPRALYIIRREIIAAVSRDRRLGASLLRLHFHDCFVQGCDASVLLKDTPTFQGEQNARPNANSLRGFEFIDSLKAKIEAVCPNVVSCADILAVAARDSVATLGGPIWGVRLGRRDSTTANFNAANSDLPSPFLNLSGLIAAFKKKGFSADEMVALSGAHTIGKAKCAVFKNRIYNESNINPYYRRSLQNTCPRNGGDNNLANLDSTTPAFFDSAYYRNLLFKRGLLHSDQELYNGGSTDYKVLAYARNPYLFRFDFAKAMIKMGNLSPLTGNQGQIRKYCSRVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 3 introns) and 19 ESTs. Cultivar="genotype A17".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTATTGTTACTCATTCCAGTGTGATATTTTGTGTAATGATATGTCTTATTGGCATAGTTTCAGCTTCAAATGTAATTCCTTCAGCAACTACTTTGGTGTCTTCTTTAATACCTACC
CCTAATTATAGTGAGTTGAGTTCTACATTTTATGGTACAAGATGTCCTCGTGCTCTTTATATCATTAGGAGAGAAATAATTGCTGCTGTGTCGAGAGATCGTCGCTTAGGTGCATCCTTG
CTCCGTCTTCATTTCCATGATTGCTTTGTTCAA
GTAAGTTTTCGTAGCTCCATTTCTCTTTAAAATCGTTTCCATAAATATTCTTCTTATATATTTGTTGCTTGATTTTTGAAGGGGTGT
GATGCATCAGTATTGTTGAAAGACACACCAACTTTCCAGGGAGAACAAAATGCAAGACCCAATGCCAATTCTCTCAGGGGTTTCGAATTCATAGACAGTTTAAAAGCTAAAATAGAAGCA
GTGTGTCCCAATGTTGTTTCTTGTGCAGATATCTTAGCAGTTGCAGCCAGAGATTCTGTTGCTACT
GTAAGTATTCTTTTCTAAAAAAATAGTTAATTCAACAAAGTTGTTAAATTGGCA
ACAAAATAATTTTTGTCGTAACACTTCGATTCTCATGGGAGAGAGCTATGATAATCGGGAGTTCAGCAAGAACGTAAATAATGTCCGACCAATGATTGTTAATTTCAGCGTTAATAAAAT
ATGCTTTTATGATTTACAAACATCAAAATTGAAGACTAATAATTCATTTATGTTTATTTATATACATTTATATGCATGTACAATTTTAGGCCTAATAGTGTTGATGAATGATAAATATAT
TACCAGCTTGGTGGACCTATTTGGGGAGTTCGTTTGGGCAGAAGAGATTCAACAACTGCAAATTTTAATGCTGCTAATTCAGATTTACCTTCTCCATTCCTTAATCTTAGTGGCCTTATT
GCTGCTTTCAAGAAAAAGGGTTTCTCAGCTGATGAAATGGTTGCTTTATCAG
GTAAACACGAAAAAGAACGACGATACTTACAAGAGATACTCCAACCTATATACAATTAGCTAATAAAC
ACGAAACAAAAATTCAACAACACGTAAGAGGAATACGTTCTTACTATGCATTTGAATTGATCGACACAATTTCCTAAATAATACGATAGCAATATATTCCTAACTTGATCTAACGACCTA
TATTTGATTTTCATATGTTTTGGCGAGAACAATTATAATTAAATTAACGACTAGAGTTGATTATAACCTAAAGTCTAATTTTATAGTTTTTGTCTCCAAATGCGATCTCAAATTTATTGT
TCATCTCGCATAACAAGTTAAATTTGTTTTTCTTTAGGTGCTCACACAATCGGAAAAGCAAAATGTGCAGTATTTAAAAACCGGATTTACAACGAAAGCAACATAAATCCTTATTACAGA
AGATCATTGCAAAACACATGTCCAAGGAATGGTGGTGATAACAACTTAGCCAATTTAGACAGCACAACTCCAGCATTCTTTGACAGTGCTTATTACAGAAATTTATTATTCAAAAGGGGT
CTTTTGCATTCTGATCAAGAACTCTATAACGGCGGTTCAACCGACTACAAAGTTTTGGCTTATGCAAGAAATCCGTATCTCTTTAGATTCGATTTCGCTAAGGCGATGATTAAGATGGGA
AATCTTAGCCCTCTTACTGGAAACCAGGGTCAGATCAGAAAATATTGCAGCAGAGTGAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTATTGTTACTCATTCCAGTGTGATATTTTGTGTAATGATATGTCTTATTGGCATAGTTTCAGCTTCAAATGTAATTCCTTCAGCAACTACTTTGGTGTCTTCTTTAATACCTACC
CCTAATTATAGTGAGTTGAGTTCTACATTTTATGGTACAAGATGTCCTCGTGCTCTTTATATCATTAGGAGAGAAATAATTGCTGCTGTGTCGAGAGATCGTCGCTTAGGTGCATCCTTG
CTCCGTCTTCATTTCCATGATTGCTTTGTTCAA
GGGTGTGATGCATCAGTATTGTTGAAAGACACACCAACTTTCCAGGGAGAACAAAATGCAAGACCCAATGCCAATTCTCTCAGGGGT
TTCGAATTCATAGACAGTTTAAAAGCTAAAATAGAAGCAGTGTGTCCCAATGTTGTTTCTTGTGCAGATATCTTAGCAGTTGCAGCCAGAGATTCTGTTGCTACT
CTTGGTGGACCTATT
TGGGGAGTTCGTTTGGGCAGAAGAGATTCAACAACTGCAAATTTTAATGCTGCTAATTCAGATTTACCTTCTCCATTCCTTAATCTTAGTGGCCTTATTGCTGCTTTCAAGAAAAAGGGT
TTCTCAGCTGATGAAATGGTTGCTTTATCAG
GTGCTCACACAATCGGAAAAGCAAAATGTGCAGTATTTAAAAACCGGATTTACAACGAAAGCAACATAAATCCTTATTACAGAAGATCA
TTGCAAAACACATGTCCAAGGAATGGTGGTGATAACAACTTAGCCAATTTAGACAGCACAACTCCAGCATTCTTTGACAGTGCTTATTACAGAAATTTATTATTCAAAAGGGGTCTTTTG
CATTCTGATCAAGAACTCTATAACGGCGGTTCAACCGACTACAAAGTTTTGGCTTATGCAAGAAATCCGTATCTCTTTAGATTCGATTTCGCTAAGGCGATGATTAAGATGGGAAATCTT
AGCCCTCTTACTGGAAACCAGGGTCAGATCAGAAAATATTGCAGCAGAGTGAATTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCTCTTATTA AGAGTTGCTA CTAACAAAAA TTAACATGGC TATTGTTACT CATTCCAGTG TGATATTTTG TGTAATGATA TGTCTTATTG GCATAGTTTC AGCTTCAAAT GTAATTCCTT  CAGCAACTAC TTTGGTGTCT TCTTTAATAC CTACCCCTAA TTATAGTGAG TTGAGTTCTA CATTTTATGG TACAAGATGT CCTCGTGCTC TTTATATCAT TAGGAGAGAA ATAATTGCTG  CTGTGTCGAG AGATCGTCGC TTAGGTGCAT CCTTGCTCCG TCTTCATTTC CATGATTGCT TTGTTCAAGG GTGTGATGCA TCAGTATTGT TGAAAGACAC ACCAACTTTC CAGGGAGAAC  AAAATGCAAG ACCCAATGCC AATTCTCTCA GGGGTTTCGA ATTCATAGAC AGTTTAAAAG CTAAAATAGA AGCAGTGTGT CCCAATGTTG TTTCTTGTGC AGATATCTTA GCAGTTGCAG  CCAGAGATTC TGTTGCTACT CTTGGTGGAC CTATTTGGGG AGTTCGTTTG GGCAGAAGAG ATTCAACAAC TGCAAATTTT AATGCTGCTA ATTCAGATTT ACCTTCTCCA TTCCTTAATC  TTAGTGGCCT TATTGCTGCT TTCAAGAAAA AGGGTTTCTC AGCTGATGAA ATGGTTGCTT TATCAGGTGC TCACACAATC GGAAAAGCAA AATGTGCAGT ATTTAAAAAC CGGATTTACA  ACGAAAGCAA CATAAATCCT TATTACAGAA GATCATTGCA AAACACATGT CCAAGGAATG GTGGTGATAA CAACTTAGCC AATTTAGACA GCACAACTCC AGCATTCTTT GACAGTGCTT  ATTACAGAAA TTTATTATTC AAAAGGGGTC TTTTGCATTC TGATCAAGAA CTCTATAACG GCGGTTCAAC CGACTACAAA GTTTTGGCTT ATGCAAGAAA TCCGTATCTC TTTAGATTCG  ATTTCGCTAA GGCGATGATT AAGATGGGAA ATCTTAGCCC TCTTACTGGA AACCAGGGTC AGATCAGAAA ATATTGCAGC AGAGTGAATT AAGTTTGAAT TTGGTCATGT ACAAGTATTA  AATCATAAAT GTGTCAAATA TTGTTCATTA GTATCAAGTT GTTAAAAAGG AATACATGGC ACAAGTGTTT AATATAGGAG TTCTTATTAG TATCTAGTGC TTTATGAATA TGTCCTTTGT 
AATGTAATTT TCTATTTTCT TTTGGTATTT GAAATTATGA TTATTTTTTA TTATTAATAT TAATTCAATT GGTGACATAC CTTTGCC 

Retrieve as FASTA