Entry information : SbAPx02 (Sobic.002G431100.1 [2.1] / Sb02g044060 [1.4])
Entry ID 3501
Creation 2006-08-16 (Felipe Teixeira)
Last sequence changes 2006-08-16 (Felipe Teixeira)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbAPx02 (Sobic.002G431100.1 [2.1] / Sb02g044060 [1.4])
Name (synonym) SbAPx02 (Sobic.002G431100.1 [2.1] / Sb02g044060 [1.4])
Class Ascorbate peroxidase    [Orthogroup: APx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation Cytosolic
Tissue types Callus
Flowers
Inflorescences
Leaves
Ovaries
Roots
Seedlings
Seeds
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbAPx02
start..stop
S start..stop
ZmAPx02_B73 509 0 1..250 1..250
ZmAPx02_H99 504 0 1..250 1..250
SiAPx02 497 0 1..250 1..250
HvAPx03 480 4e-175 3..250 4..251
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 77865528..77865646 119 N° 2 77865252..77865426 175 N° 3 77865078..77865143 66 N° 4 77864161..77864209 49
N° 5 77863582..77863667 86 N° 6 77863412..77863491 80 N° 7 77863162..77863264 103 N° 8 77863006..77863064 59
N° 9 77862904..77862919 16  
complement(join(77862904..77862919,77863006..77863064,77863162..77863264,7786341 2..77863491,77863582..77863667,77864161..77864209,77865078..77865143,77865252..7 7865426,77865528..77865646))


exon

Literature and cross-references SbAPx02 (Sobic.002G431100.1 [2.1] / Sb02g044060 [1.4])
DNA ref. Phytozome 12:   chromosome_2 (77865646..77862904)
Cluster/Prediction ref. UniGene:   Sbi.798
Protein sequence: SbAPx02 (Sobic.002G431100.1 [2.1] / Sb02g044060 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   250
PWM (Da):   %s   27071.66  
PI (pH):   %s   5.15
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVKAYPTVSEDYLKAVDKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDVATKTGGPFGTMKNPAEQAHGANAGLEIAVRLLEPIKEQFPILSYADFYLAGVVAVEVTGGPDVPFHPGRQDKPEPPPEGRLPDATQGSDHLRQVFSTQMGLSDQDIVALSGGHTGRCHKDRSGFEGAWTSNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPSFRPLVDKYADEDAFFADYAEAHLKLSELGFAEA

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 8 introns) and 96 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAAGGCCTACCCCACGGTGAGTGAGGACTACCTCAAGGCGGTCGACAAGGCCAAGCGCAAGCTCCGCGGCCTCATCGCTGAGAAGAACTGCGCCCCGCTCATGCTCCGCCTCGCG
TAAGCCCTCTCCCACTTCTTCTTCGCCCGATCCCGATCCCGATCCGATTCGGAAATCCCGAAACTACTTCCACTCCCAACTCCTTCCTTCCTCCTCGCAGCTGGCACTCCGCGGGCACCT
TCGATGTGGCCACCAAGACCGGGGGGCCCTTCGGCACCATGAAGAACCCCGCCGAGCAGGCGCACGGAGCCAACGCCGGACTGGAAATTGCCGTCAGGCTGCTAGAGCCTATCAAGGAGC
AGTTCCCCATCCTATCCTATGCTGACTTCTACCAG
GTTACCTGCCTGCCTGAGATTGCAACTCTGATCACCCATCCATTCGTCTGATTCTATCTAGATTGACTAACGAATTTTATGGTCT
TATTCACTGTGTGGTTGTTGCAGCTTGCCGGAGTCGTGGCAGTTGAGGTAACCGGCGGACCTGATGTCCCCTTCCACCCTGGGAGGCAGGTGAGGCGGATTCCTTTTTCTAATAACCCTT
TTTAGTTTTATTATATTATTATTAGATAGAAAAAAATCATCAAGCCCCAGCCTAACCCAACCCAAACCAGAGATTTTGTTAGGGTTTAAGCAAAATAAACCCTAGTCGCTACCAATTGTA
CCTGCGACACCCTGGCTCGCTGACACGTGCTCATGCGTAGCACATGGTGGCTTAACTCCAGCCTCTGTTGGCTTTAGCTATTACCATACATTCTGGATTCATGTGATGCTAGTTCTTGCA
ATCCCTCATCGTGTGGACAATGATTTCAGATGTTTCTCAGGTTGGATGGACCGTTGATAGGTTGGCAATTGACATTTACCCCTTTTATGTGCCACGTTTAAAATTCTTGTGAATTTGTGA
TAGTGTATTGGTTTGCCAAATAAAATTCCCTAGCTACATTATCAGCCCGTCACATGAGAGAGTGGTAATATTAGGAGGACAGTTGTGCCATGGAGCTAGTTGATCTGCTGCATAGGGTCC
ATATGCATTAGATGCTATTTTGCGTGTTTGTTCATATAGTAGTATATTACTCATTCTGCAGATGTTTTGACTGTTCGCTGGCCAGCTTCTGGTTAAATAGATGGTGATCGTGTAATTAGT
AACTAGCTATGTCCTGTGACCTGTGTGTAGCATTTTATCCAGTCCTTAAAATACTTGTTCTAGTTTATCGCCTAAGACTCTTGCCTTGGGTTAGTAGTATTTCTATTTGTTCGCTGTAGA
AGCTACATCATCTGCTAGTGGGAATATGTTATTATGCTTTGTTTCAGACTGCAGTTTCTTTACTGTATTGATCTTCTAGCTGTGGCTGTTGATGAAATCATTGTTTTTATTCTGTAGGAC
AAGCCTGAGCCTCCGCCAGAAGGCCGCCTTCCTGATGCCACCCAAG
GTACAGGCCTTGTTTAGTTCCGAAAAAAATTCGGATTTTGACACTGTAGCACTTTCGTTTGTTTGTGACAAATA
ATATTCAACTATAGACTAACTAGGATCAAAAGATTCGTCTTGTGATTTACACCTAAACTGTGTAATTAGTTTTTTTTCGTATATATTTAATGCTTCATGCAAGTGCTATAAGATTCGATG
TGACGGGGAATCTTGAAAACTTTTTGGTTTTCGGGGTGAACTAAACAAGGCCACAATTATAGAATTCCTCTGATATTGCTGAAGCTTCTGCCTTGATGTAGGCATGCTTCTGGGTGCACT
GTGTGTGATCCTTCTTTGACTATACAAGAAATCTACTCAGTTAGTGCATAAGAATTCGTGAGGAACATTTGATCTGAGTTCTTGGATTGCCTTCTTTGTCGTGTCAAGGATAAAGTTAGA
ATGTTTCTCAATGGTACAAATGGGATAGGTGGACTTACTGGTTTGGTCTCTTGTATCAGGTTCTGATCACCTCAGGCAGGTTTTCTCCACACAGATGGGTTTGAGCGACCAGGACATTGT
TGCACTTTCTGGTGGTCACACCCTG
GTTGGTGGAACTGGTCACCTAGCCTGTGTATTTTTTTGGGTGTTTGGCAACTTGAAAGGTGGTGCTTATGCAGAATTGTCTCTCTTGTAGGGAAG
ATGCCACAAGGATAGATCTGGGTTTGAGGGAGCCTGGACATCCAACCCTTTAATCTTTGACAACTCTTACTTCAC
GTACGTGATCTGTTTCTTTTGAAGAAGGCAACTCTTATTTCTACT
CATACCATGTTTTGTTGGTTAAACTGAATAGCTGTGTTACAATCCTGGAGCATGAACTCTGACACGAGTCTTCATTAAGATAAGTTGAATAAACTATGACAGGGAGCTTCTGAGTGGAGA
GAAGGAAGGCCTTCTACAGCTACCAAGTGACAAAGCCCTCCTCTCTGATCCATCCTTCCGCCCACTTGTTGACAAATATGCAGCG
GTATGTCATTTAATCCTTGCATAGTTCTCATTTGT
TGGGGAGTCGGCCTTTAGCTTGCAGGTTTATGATACCTGTGATGATTTTGCCTGATTTGTAGGATGAGGACGCTTTCTTTGCTGACTACGCCGAGGCCCACCTGAAGCTTTCCGAATTGG
G
GTAAGTGGTGCTGATCGGTCTCTCCCCGTGATCGAATGCCTGTTTACTACTAGGGCAACAAACACTAAATCTCTTGCACTGTGCAGATTTGCTGAGGCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAAGGCCTACCCCACGGTGAGTGAGGACTACCTCAAGGCGGTCGACAAGGCCAAGCGCAAGCTCCGCGGCCTCATCGCTGAGAAGAACTGCGCCCCGCTCATGCTCCGCCTCGCC
TGGCACTCCGCGGGCACCTTCGATGTGGCCACCAAGACCGGGGGGCCCTTCGGCACCATGAAGAACCCCGCCGAGCAGGCGCACGGAGCCAACGCCGGACTGGAAATTGCCGTCAGGCTG
CTAGAGCCTATCAAGGAGCAGTTCCCCATCCTATCCTATGCTGACTTCTACCAG
CTTGCCGGAGTCGTGGCAGTTGAGGTAACCGGCGGACCTGATGTCCCCTTCCACCCTGGGAGGCAG
GACAAGCCTGAGCCTCCGCCAGAAGGCCGCCTTCCTGATGCCACCCAAGGTTCTGATCACCTCAGGCAGGTTTTCTCCACACAGATGGGTTTGAGCGACCAGGACATTGTTGCACTTTCT
GGTGGTCACACCCTG
GGAAGATGCCACAAGGATAGATCTGGGTTTGAGGGAGCCTGGACATCCAACCCTTTAATCTTTGACAACTCTTACTTCACGGAGCTTCTGAGTGGAGAGAAGGAA
GGCCTTCTACAGCTACCAAGTGACAAAGCCCTCCTCTCTGATCCATCCTTCCGCCCACTTGTTGACAAATATGCAGCG
GATGAGGACGCTTTCTTTGCTGACTACGCCGAGGCCCACCTG
AAGCTTTCCGAATTGGG
ATTTGCTGAGGCGTAA

Retrieve as FASTA