Entry information : MtPrx32 (Medtr4g029190.1 [4.0])
Entry ID 357
Creation 2006-06-01 (Christophe Dunand)
Last sequence changes 2014-07-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-07-29 (Christophe Dunand)
Peroxidase information: MtPrx32 (Medtr4g029190.1 [4.0])
Name (synonym) MtPrx32 (Medtr4g029190.1 [4.0])
Class Class III peroxidase    [Orthogroup: Prx168]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Mixed tissues
Root tips
Seedling roots
Inducers Glomus intraradices infection
Glomus mosseae infection
Nitrogen starvation
Nodulation
Sinorhizobium inoculation
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx32
start..stop
S start..stop
MtPrx24 529 0 1..340 1..338
GmPrx135 425 1e-150 13..340 12..330
AhPrx04 422 2e-149 7..340 6..316
ShPrx06-1B 418 6e-148 42..340 24..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10076104..10076376 273 N° 2 10075302..10075493 192 N° 3 10075014..10075179 166 N° 4 10074373..10074767 395
complement(join(10074373..10074767,10075014..10075179,10075302..10075493,1007610 4..10076376))


exon

Literature and cross-references MtPrx32 (Medtr4g029190.1 [4.0])
Literature REFERENCE 1. VandenBosch,K. et al., unpublished
REFERENCE 2. Natalija Hohnjec, Martin F. Vieweg, Alfred Puhler, Anke Becker, and Helge Kuster. Overlaps in the Transcriptional Profiles of Medicago truncatula Roots Inoculated with Two Different Glomus Fungi Provide Insights into the Genetic Program Activated during Arbuscular Mycorrhiza. Plant Physiol. 137: 1283-1301(2005).
DNA ref. Phytozome 11:   chr4 (10076376..10074373)
Cluster/Prediction ref. Phytozome Gene 11:   31109705
Omic ref. Gene atlas:   Mtr.38167.1.S1_at Legoo:   MTGI7-TC79060
Protein sequence: MtPrx32 (Medtr4g029190.1 [4.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   341 (318)
PWM (Da):   %s   36689.77 (34248.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.39 (8.37) Peptide Signal:   %s   cut: 24 range:24-341
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGVFTRSMVTFCVLICLIGIVSASSVIPSATTYVSNLIPGPSSELRPSFYLLHGCPLAVQTIRTAITTAVLKDPRLGASLLRLHFQDCFVQGCDASVLLKDTPTFKGEQNARPNANSLRGYEIIESVKAQLELLCPNVVSCADILALAARDSVVALGGPNWLVRLGRRDSTTADFNAANSDLPSPFLDLDGLIAAFKKKGFTAEEMVALSGAHTIGKAKCGLIRNRIYNESNIDPNYAKSLQAFLPCPKSGGDNNLASLDATTPNFFDNAYYRNLLNKKGLLHSDQQLYNGGSTDYKVSAYANNPLLFSIDFANAMIKMGNLSPLTGDQGQIRKYCSRVNY

Retrieve as FASTA  
Remarks Complete sequence from genomic ( chromo 4, 3 introns) and 10 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGTTTTTACTCGTTCAATGGTGACATTTTGTGTGTTGATATGTCTTATTGGCATAGTCTCAGCTTCAAGTGTAATTCCTTCAGCAACTACTTATGTGTCTAATTTGATCCCTGGT
CCTTCTAGTGAGTTGAGACCCTCTTTTTATTTGTTGCATGGGTGTCCTCTTGCTGTTCAAACCATTAGGACAGCAATAACAACTGCTGTATTGAAAGATCCTCGTTTGGGTGCATCTTTG
CTTCGTCTTCATTTTCAAGACTGCTTTGTTCAA
GTAAGTCATCGTATCGAATAATCGCTTAAAATGACTATTATTGTCACTGTTACTACTGGCGTAAAGACAAATACAAACACTAACATA
CCCGTCTTTCTGTTTTTTTATCGCATTGATTCATTTTCTTGTCGCTTCAACTTTAAAAAAAATGTTAAGAGACTGGGGTAATCTAGCCTTGGTATATATATTGTAATGTTAATGATCACA
GATACAAAAGTAGGGTTTAAGAGACATGCAATGATCGTCTCAACTCATATTTTGAGACGATTATGAATAACGTATCATTTAGAGTTTGAGAGACATGTGATCAGAGAGCAAGTGTGAGAG
GATTGACTATCGTCATCGTCATTTAGTGTATCCATACTCTAACCGTCTAATGTGACAACGGTTAAATAGTTAAACGGTTGTAGGCAGAGATCCTTCAATTGGCTAATTGACAAAATAATT
CAACTCATCATGGTCCATTCAAAAACATAGCTCAATCAAATAATTCATCGGTTACTAGTACGTACTTAATAACAATATACTCTAACCCTACGCACAAAACAAAAAATATATTGAAACTAT
TTTTATCAAAACTGTTCTAATTCTAATTGCTTGATTTTTGAAGGGGTGTGATGCATCAGTATTGTTAAAGGACACACCAACTTTCAAGGGAGAACAAAATGCCAGACCCAATGCCAATTC
TCTGAGGGGTTACGAAATCATAGAAAGTGTAAAAGCTCAATTAGAGCTACTCTGTCCCAATGTTGTTTCATGTGCAGATATATTAGCACTTGCAGCTAGAGATTCTGTTGTTGCT
GTAAG
TATTCTTCTTGAAATAGTTTTCTTTTTTATTTCTCAAATATATGAGAAATGAGAAATTATTTTGCATAAAGATAACTATATGACTAAAAGTATCAATGGATGATAATTTATTCTTAGCTT
GGTGGACCTAATTGGCTAGTTCGTTTGGGAAGACGAGACTCAACAACTGCAGATTTCAATGCTGCTAATTCTGACTTACCTTCTCCATTTCTTGACCTTGATGGCCTTATTGCTGCTTTC
AAGAAAAAGGGGTTTACAGCTGAAGAAATGGTTGCTTTATCAG
GTAAACATCCATTGCAAGCAAGCAAATTTAGTAATCATATATTTTCGTAATGGGAATCTTAATCATACATTTTCAAT
AGCCATACAATCATAAGTTGATTTTGAAGATTTAAATTTGATTTTGATATGTTTGTGAAATTTTTGATTAGAATCAATTTTGCATCTAAGACTAATTCGAACTTTATGTTAGAGTTTGTA
GTTTTAGCCACCAAATTTCATTTTTATACTCGAATTTGTTGTTGTATAGGTGCTCACACAATAGGAAAAGCAAAATGCGGCCTCATCCGAAACAGGATTTACAACGAAAGCAACATAGAT
CCTAATTACGCAAAATCATTACAAGCGTTTTTACCATGTCCAAAAAGTGGTGGTGATAACAACTTAGCTTCTTTAGACGCCACAACTCCAAATTTCTTTGACAATGCTTATTACAGAAAC
TTATTGAACAAGAAAGGTCTTTTGCATTCTGATCAACAACTCTATAATGGTGGTTCCACTGATTACAAAGTTTCAGCTTACGCCAATAACCCGTTACTCTTCAGCATCGACTTTGCTAAC
GCGATGATTAAGATGGGAAATCTTAGCCCTCTAACTGGAGACCAGGGTCAGATAAGAAAATATTGCAGCCGTGTGAATTATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGTTTTTACTCGTTCAATGGTGACATTTTGTGTGTTGATATGTCTTATTGGCATAGTCTCAGCTTCAAGTGTAATTCCTTCAGCAACTACTTATGTGTCTAATTTGATCCCTGGT
CCTTCTAGTGAGTTGAGACCCTCTTTTTATTTGTTGCATGGGTGTCCTCTTGCTGTTCAAACCATTAGGACAGCAATAACAACTGCTGTATTGAAAGATCCTCGTTTGGGTGCATCTTTG
CTTCGTCTTCATTTTCAAGACTGCTTTGTTCAA
GGGTGTGATGCATCAGTATTGTTAAAGGACACACCAACTTTCAAGGGAGAACAAAATGCCAGACCCAATGCCAATTCTCTGAGGGGT
TACGAAATCATAGAAAGTGTAAAAGCTCAATTAGAGCTACTCTGTCCCAATGTTGTTTCATGTGCAGATATATTAGCACTTGCAGCTAGAGATTCTGTTGTTGCT
CTTGGTGGACCTAAT
TGGCTAGTTCGTTTGGGAAGACGAGACTCAACAACTGCAGATTTCAATGCTGCTAATTCTGACTTACCTTCTCCATTTCTTGACCTTGATGGCCTTATTGCTGCTTTCAAGAAAAAGGGG
TTTACAGCTGAAGAAATGGTTGCTTTATCAG
GTGCTCACACAATAGGAAAAGCAAAATGCGGCCTCATCCGAAACAGGATTTACAACGAAAGCAACATAGATCCTAATTACGCAAAATCA
TTACAAGCGTTTTTACCATGTCCAAAAAGTGGTGGTGATAACAACTTAGCTTCTTTAGACGCCACAACTCCAAATTTCTTTGACAATGCTTATTACAGAAACTTATTGAACAAGAAAGGT
CTTTTGCATTCTGATCAACAACTCTATAATGGTGGTTCCACTGATTACAAAGTTTCAGCTTACGCCAATAACCCGTTACTCTTCAGCATCGACTTTGCTAACGCGATGATTAAGATGGGA
AATCTTAGCCCTCTAACTGGAGACCAGGGTCAGATAAGAAAATATTGCAGCCGTGTGAATTATTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCAGGCAAA CTATAACTTT GTGAATTCCT AATATATAAC ACAAACATGG GTGTTTTTAC TCGTTCAATG GTGACATTTT GTGTGTTGAT ATGTCTTATT GGCATAGTCT CAGCTTCAAG  TGTAATTCCT TCAGCAACTA CTTATGTGTC TAATTTGATC CCTGGTCCTT CTAGTGAGTT GAGACCCTCT TTTTATTTGT TGCATGGGTG TCCTCTTGCT GTTCAAACCA TTAGGACAGC  AATAACAACT GCTGTATTGA AAGATCCTCG TTTGGGTGCA TCTTTGCTTC GTCTTCATTT TCAAGACTGC TTTGTTCAAG GGTGTGATGC ATCAGTATTG TTAAAGGACA CACCAACTTT  CAAGGGAGAA CAAAATGCCA GACCCAATGC CAATTCTCTG AGGGGTTACG AAATCATAGA AAGTGTAAAA GCTCAATTAG AGCTACTCTG TCCCAATGTT GTTTCATGTG CAGATATATT  AGCACTTGCA GCTAGAGATT CTGTTGTTGC TCTTGGTGGA CCTAATTGGC TAGTTCGTTT GGGAAGACGA GACTCAACAA CTGCAGATTT CAATGCTGCT AATTCTGACT TACCTTCTCC  ATTTCTTGAC CTTGATGGCC TTATTGCTGC TTTCAAGAAA AAGGGGTTTA CAGCTGAAGA AATGGTTGCT TTATCAGGTG CTCACACAAT AGGAAAAGCA AAATGCGGCC TCATCCGAAA  CAGGATTTAC AACGAAAGCA ACATAGATCC TAATTACGCA AAATCATTAC AAGCGTTTTT ACCATGTCCA AAAAGTGGTG GTGATAACAA CTTAGCTTCT TTAGACGCCA CAACTCCAAA  TTTCTTTGAC AATGCTTATT ACAGAAACTT ATTGAACAAG AAAGGTCTTT TGCATTCTGA TCAACAACTC TATAATGGTG GTTCCACTGA TTACAAAGTT TCAGCTTACG CCAATAACCC  GTTACTCTTC AGCATCGACT TTGCTAACGC GATGATTAAG ATGGGAAATC TTAGCCCTCT AACTGGAGAC CAGGGTCAGA TAAGAAAATA TTGCAGCCGT GTGAATTATT GAGTTGAATT  TTGTTCTCTC CTATTACTGA AATCAAGATT ATGTCGCGGA TTTATTTGGT CGTCAATGAA GATTTTTTGT TTCGAAGTAT CTGTTAAGTA TCAAGTGGTT TTTTTTAACA AGTTTTCATT  TTTAAGTGTT AAGTGTTCGT CATCCTATAT TTTGACAATT TTTTGGATAT TTTTATTATT TGATGAATGT CCCTTTAAAT TTGTATTGTA AATTTATGTT TTTCTTTTGG TATTTGAAAC 
TATGTCAATT TTTTTTATTA TATATATTGT TTTCAATTGG TATTATATAT GCCTTGTTCT TTCAGTTTAA TATAATTTGT GAGGCTTCTG GA 

Retrieve as FASTA