Entry information : MtPrx34 (Medtr3g072190.1[4.0] / Medtr3g072190.1[3.5] / Medtr3g097330.1[3.0])
Entry ID 359
Creation 2006-06-21 (Christophe Dunand)
Last sequence changes 2010-09-16 (Haythem Mhadhbi)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-07-29 (Messaoudi)
Peroxidase information: MtPrx34 (Medtr3g072190.1[4.0] / Medtr3g072190.1[3.5] / Medtr3g097330.1[3.0])
Name (synonym) MtPrx34 (Medtr3g072190.1[4.0] / Medtr3g072190.1[3.5] / Medtr3g097330.1[3.0])
Class Class III peroxidase    [Orthogroup: Prx040]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Cell culture
Immature pods
Leaves
Roots
Roots hairs
Roots nodules
Stems
Inducers Drought
Glomus versiforme infection
Insect damage (Spodoptera exigua, Meloidogyne, Aphib)
Sinorhizobium inoculation
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx34
start..stop
S start..stop
MtPrx37 585 0 1..318 1..320
GmPrx22 510 0 1..318 1..314
LjPrx15 501 0 1..318 1..316
MePrx35 462 8e-166 1..318 1..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 32425013..32425225 213 N° 2 32424731..32424922 192 N° 3 32424036..32424201 166 N° 4 32423488..32423873 386
complement(join(32423488..32423873,32424036..32424201,32424731..32424922,3242501 3..32425225))


exon

Literature and cross-references MtPrx34 (Medtr3g072190.1[4.0] / Medtr3g072190.1[3.5] / Medtr3g097330.1[3.0])
Literature Torres-Jerez,I. et al., unpublished
Protein ref. UniProtKB:   Q1RXM7
DNA ref. Phytozome 11:   chr3 (32425225..32423488)
Cluster/Prediction ref. Phytozome Gene 11:   31061476
Omic ref. Gene atlas:   Mtr.24535.1.S1_at Legoo:   Mtr.24535.1.S1_at
Protein sequence: MtPrx34 (Medtr3g072190.1[4.0] / Medtr3g072190.1[3.5] / Medtr3g097330.1[3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (296)
PWM (Da):   %s   34375.59 (32042.4)  
PI (pH):   %s   9.11 (9.50) Peptide Signal:   %s   cut: 23 range:23-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASYYFLLFVLVAASAISEADAKKKLSKDFYCSSCPELLSIVNQGVINAIKKETRIGASLLRLHFHDCFVNGCDASILLDDTSSFIGEKTAAANNNSARGFNVIDDIKANVEKACPGVVSCADILTLAARDSVVHLGGPSWNVGLGRRDSITASRSDANNSIPAPFLNLSALKTNFANQGLSAKDLVALSGAHTIGLARCVQFRAHIYNDSNVDSLFRKSLQNKCPRSGNDNVLEPLDHQTPTHFDNLYFKNLLAKKALLHSDQELFNGSSTDNLVRKYATDNAKFFKAFAKGMVKMSSIKPLTGSNGQIRTNCRKIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 3 introns) and 15 partial cDNA.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTACTACTTCCTCTTATTTGTTCTTGTTGCTGCTTCTGCAATATCTGAAGCAGATGCCAAAAAGAAGTTATCTAAAGACTTCTACTGCAGCAGCTGTCCGGAACTGTTGTCT
ATAGTGAACCAAGGAGTCATAAATGCCATTAAGAAAGAAACTCGAATAGGAGCTTCTTTACTTCGATTGCATTTCCATGACTGCTTTGTAAAC
GTGAGTATATACTATATATATATTAAT
TTAACTTGATTTTAATTCTCTTCTTCACTTAATTTAGTCCCATTTAACGCAATGATCATTAAGGGGTGTGATGCATCAATACTTTTGGATGATACAAGCAGTTTCATAGGAGAAAAAACA
GCAGCTGCTAACAATAATTCAGCTAGAGGATTCAACGTGATTGATGACATCAAAGCCAATGTGGAAAAAGCATGCCCAGGGGTTGTGTCCTGTGCTGATATTCTTACCCTGGCTGCCCGG
GACTCTGTTGTTCAT
GTGAGTTATGTTGTTTTGACATAAATTTGACATCAAAATTCAAAAACAATTTAGATGGTTAATCAAATTTAGTATATAGTTCATAAATATAACAAAAACTGTCAC
AACTCATTGATTCTCCATAAAACACAATAAACATGTCATTCACCATAACTTTTTAAGTGTTCAAATAAACATACATATTTAGTAACAATTTAAATTGTATTCAAATATACATAATTTTTA
GATGTTCAAATATAATGACATTAATTAACCACGATTTATATTCAAATATACATCTGGAAATCGTTGTTAATTGTGTTAAGTGGATGGATAATGAATTGGAACACATTGTTATATTCATTA
ACCACATATGTGAACCATGTCAGCCATCTAGATTATTGTGGAATTTTGATGTAAATTGGTGTTTCAAAATATAAATTCTATCATGTAACATCATATTCCAATAGAACAATGATACCGTAC
TATCCTCTTCATTAGAGTGATTTAATTGATCTATAAAGGGTTATATGGTTGTTGGAATTTACAGCTAGGAGGCCCTTCATGGAATGTAGGCTTGGGAAGAAGGGATTCAATCACAGCTAG
TAGATCTGATGCCAATAACTCAATTCCTGCACCATTTCTCAATCTAAGCGCTCTCAAAACAAATTTTGCTAACCAAGGACTCTCAGCTAAGGACTTGGTGGCTCTTTCAG
GTACCACAGT
ATCCCTATATATTAATGCTTTATCATGATTCATGACCACAACTTTATTCAAAAATTCTCAGTAAGAAGAATTTGGCATTCAATTAAGGCGCCTTCAATTAATGTCCAATATTAGTACTGT
TTCAACTCAATTGAGTGTATCTTGAATAACAGGTGCACATACAATTGGCCTAGCTAGATGTGTACAATTTCGAGCACACATCTACAATGACTCCAACGTTGACTCCTTATTTAGAAAGTC
TCTACAAAACAAATGCCCCAGAAGTGGAAATGACAATGTGCTTGAACCCCTCGACCATCAAACACCGACTCATTTCGATAACCTATACTTCAAGAATTTACTAGCTAAAAAGGCTCTTCT
CCATTCAGACCAGGAGCTATTCAATGGAAGCTCTACCGATAATCTGGTAAGGAAATATGCTACTGATAATGCTAAATTTTTTAAAGCCTTTGCCAAGGGTATGGTCAAAATGAGTAGCAT
CAAGCCCCTCACAGGAAGCAATGGACAGATCAGAACCAATTGCAGAAAAATCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTACTACTTCCTCTTATTTGTTCTTGTTGCTGCTTCTGCAATATCTGAAGCAGATGCCAAAAAGAAGTTATCTAAAGACTTCTACTGCAGCAGCTGTCCGGAACTGTTGTCT
ATAGTGAACCAAGGAGTCATAAATGCCATTAAGAAAGAAACTCGAATAGGAGCTTCTTTACTTCGATTGCATTTCCATGACTGCTTTGTAAAC
GGGTGTGATGCATCAATACTTTTGGAT
GATACAAGCAGTTTCATAGGAGAAAAAACAGCAGCTGCTAACAATAATTCAGCTAGAGGATTCAACGTGATTGATGACATCAAAGCCAATGTGGAAAAAGCATGCCCAGGGGTTGTGTCC
TGTGCTGATATTCTTACCCTGGCTGCCCGGGACTCTGTTGTTCAT
CTAGGAGGCCCTTCATGGAATGTAGGCTTGGGAAGAAGGGATTCAATCACAGCTAGTAGATCTGATGCCAATAAC
TCAATTCCTGCACCATTTCTCAATCTAAGCGCTCTCAAAACAAATTTTGCTAACCAAGGACTCTCAGCTAAGGACTTGGTGGCTCTTTCAG
GTGCACATACAATTGGCCTAGCTAGATGT
GTACAATTTCGAGCACACATCTACAATGACTCCAACGTTGACTCCTTATTTAGAAAGTCTCTACAAAACAAATGCCCCAGAAGTGGAAATGACAATGTGCTTGAACCCCTCGACCATCAA
ACACCGACTCATTTCGATAACCTATACTTCAAGAATTTACTAGCTAAAAAGGCTCTTCTCCATTCAGACCAGGAGCTATTCAATGGAAGCTCTACCGATAATCTGGTAAGGAAATATGCT
ACTGATAATGCTAAATTTTTTAAAGCCTTTGCCAAGGGTATGGTCAAAATGAGTAGCATCAAGCCCCTCACAGGAAGCAATGGACAGATCAGAACCAATTGCAGAAAAATCAACTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTTACATGGC TTCTTACTAC TTCCTCTTAT TTGTTCTTGT TGCTGCTTCT GCAATATCTG AAGCAGATGC CAAAAAGAAG TTATCTAAAG ACTTCTACTG CAGCAGCTGT CCGGAACTGT  TGTCTATAGT GAACCAAGGA GTCATAAATG CCATTAAGAA AGAAACTCGA ATAGGAGCTT CTTTACTTCG ATTGCATTTC CATGACTGCT TTGTAAACGG GTGTGATGCA TCAATACTTT  TGGATGATAC AAGCAGTTTC ATAGGAGAAA AAACAGCAGC TGCTAACAAT AATTCAGCTA GAGGATTCAA CGTGATTGAT GACATCAAAG CCAATGTGGA AAAAGCATGC CCAGGGGTTG  TGTCCTGTGC TGATATTCTT ACCCTGGCTG CCCGGGACTC TGTTGTTCAT CTAGGAGGCC CTTCATGGAA TGTAGGCTTG GGAAGAAGGG ATTCAATCAC AGCTAGTAGA TCTGATGCCA  ATAACTCAAT TCCTGCACCA TTTCTCAATC TAAGCGCTCT CAAAACAAAT TTTGCTAACC AAGGACTCTC AGCTAAGGAC TTGGTGGCTC TTTCAGGTGC ACATACAATT GGCCTAGCTA  GATGTGTACA ATTTCGAGCA CACATCTACA ATGACTCCAA CGTTGACTCC TTATTTAGAA AGTCTCTACA AAACAAATGC CCCAGAAGTG GAAATGACAA TGTGCTTGAA CCCCTCGACC  ATCAAACACC GACTCATTTC GATAACCTAT ACTTCAAGAA TTTACTAGCT AAAAAGGCTC TTCTCCATTC AGACCAGGAG CTATTCAATG GAAGCTCTAC CGATAATCTG GTAAGGAAAT  ATGCTACTGA TAATGCTAAA TTTTTTAAAG CCTTTGCCAA GGGTATGGTC AAAATGAGTA GCATCAAGCC CCTCACAGGA AGCAATGGAC AGATCAGAAC CAATTGCAGA AAAATCAACT  GAAAATTAGT AATATGTATC TATAATAATA CATATATGTA TGAGTGTGTA ATTATCCATC TACATTTTCA AAATCATGCC TAATGATACT GTTTCATTTT TCGTTAGGCA AATAAAATGT 
AAACATGGTA AGATATTCAT TTATAGCAAG TTTTGTATTG TAAGCAAAT 

Retrieve as FASTA