Entry information : HsGPx02 (GSHPx-2 / GPx-2)
Entry ID 3601
Creation 2007-01-04 (Marcia Pinheiro Margis)
Last sequence changes 2010-11-23 (Myriam Duval)
Sequence status complete
Reviewer Harold Duruflé
Last annotation changes 2016-06-28 (Harold Duruflé)
Peroxidase information: HsGPx02 (GSHPx-2 / GPx-2)
Name (synonym) HsGPx02 (GSHPx-2 / GPx-2)
Class Animal glutathione peroxidase    [Orthogroup: Gpx1004]
Taxonomy Eukaryota Metazoa Chordata Mammalia Hominidae Homo
Organism Homo sapiens (human)    [TaxId: 9606 ]
Cellular localisation Cytosolic
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HsGPx02
start..stop
S start..stop
PtroGPx02 392 3e-142 1..190 1..190
HlGPx02 392 4e-142 1..190 1..190
PpyGPx02 390 2e-141 1..190 1..190
CjaGPx02 389 4e-141 1..190 1..190
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 65409223..65409444 222 N° 2 65406209..65406556 348  
complement(join(65406209..65406556,65409223..65409444))


exon

Literature and cross-references HsGPx02 (GSHPx-2 / GPx-2)
Literature REFERENCE 1 Sukenaga Y., Ishida K., Takeda T., Takagi K. cDNA sequence coding for human glutathione peroxidase. Nucleic Acids Res. 15:7178-7178(1987).

REFERENCE 2 Ishida K., Morino T., Takagi K., Sukenaga Y. Nucleotide sequence of a human gene for glutathione peroxidase.
Nucleic Acids Res. 15:10051-10051(1987).

REFERENCE 3 Mullenbach G.T., Tabrizi A., Irvine B.D., Bell G.I., Hallewell R.A. Sequence of a cDNA coding for human glutathione peroxidase confirms TGA encodes active site selenocysteine. Nucleic Acids Res. 15:5484-5484(1987).

REFERENCE 4 Chada S., le Beau M.M., Casey L., Newburger P.E. Isolation and chromosomal localization of the human glutathione peroxidase gene. Genomics 6:268-271(1990).
Protein ref. UniProtKB:   P18283
Cluster/Prediction ref. Genebank:   2877 UniGene:   Hs.2704
Protein sequence: HsGPx02 (GSHPx-2 / GPx-2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   190
PWM (Da):   %s   21677.08  
PI (pH):   %s   7.93
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASL*GTTTRDFTQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLKVAI

Retrieve as FASTA  
Remarks Complete sequence from 347 ESTs, 9 cDNA and DNA (chromo, 1 intron).
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGAACTG CTCAACACAC AGATCTCCTA CTCCATCCAG TCCTGAGGAG CCTTAGGATG CAGCATGCCT TCAGGAGACA CTGCTGGACC TCAGCATTCC CTTGATATCA GTCCCCTTCA  CTGCAGAGCC TTGCCTTTCC CCTCTGCCTG TTTCCTTTTC CTCTCCCAAC CCTCTGGTTG GTGATTCAAC TTGGGCTCCA AGACTTGGGT AAGCTCTGGG CCTTCACAGA ATGATGGCAC  CTTCCTAAAC CCTCATGGGT GGTGTCTGAG AGGCGTGAAG GGCCTGGAGC CACTCTGCTA GAAGAGACCA ATAAAGGGCA GGTGTGGAAA CGGCCAGCCT GTGTGTGTGT TCTTTGACAG  AGGGCGGAGG GAAGCTACAA ACTGCAGGTG GGATAGAGGA GCTGCTAGCA CACAAAGCTT TGGGAGGGGA GGATCTGACG GATCAAGGGA TGCCCTAATT ACTGACAGGA AAGCAAGCGC  TGGCCAAGGT CTGCAGTGGC AGGTGCAGTT ACGGGAAATG TGAATTATAT TATTCCTTTA CAGCTCTTCT TCAGAACTGG GGAAAAAGAG AAAGTGATAA TGGGAGGTAG AGGAGGAAAA  GACAATGAGC CCTTTGGTTG GGGATATTGG GAGGCTGTTA GGAGGATTAC AGTCAGGAAG CATCAATAGC ACTGTGGGTA CTGGGCCAAC TAGATCTGAC TTGTGCCTTG GGAAATTCCT  GGGCAGTCAG CTTAGTTAAT GTTTACCAAT AGCAAGGGCA TAGAGGGTGT AGTTACTGAG AACACAAACA GCACTTTATC TTTTTCCTGA TCATCAAACA TCTCGGGTGT TTGATCCTTT  GCTAGACTGA TTCTCCCTCC TTTTTAAAGT TCATGGCCCG GGTGTGGTGG CTCACACCTA TAATCCCAGC ACTTTGAGAG GCCGAGACAG GCGGATCACT TGAGGTCAGG AGTTCGAGAC  CAGCCTGGCC AACATGATGA AACTCTGTCT GTACTAAAAA TACAAAAAAT TAGCCAGGTG TGGTGGCGCA CGCCTGTAAT CCCAGCTACT CAGGAGGCTG AGGTGAGAGA CTCATTTGAA  CCCGGGAGGT GGAGGCTGCA GTGAGCCAAG ATGGCGGCGC CACTACACTC CAGCCTGGGC GACAGAGTGA GACTCCGTCT CAAAATAAAT AAATAAAGTT CACATTACAC CCTCATTCTT  CTCAAAATCA CATATTCACA AATTCAGGCT CCAGACAAAT AGAGGCAGGA ATGACTGGAC TCATTTCTTC CTCTGTAAGA AGGAAGGGGT TGGGGATGGG AGAGAGCCTC CCTTCAGAGT  CAGGCTGTTT ATAATCTGCC ATTTGCAACA TCATTATTCC TCACTGTGAG GACAGTTTTG CTCAGAGGCC TTGCAAGGAT GGTGTCCCCA ATTCCTCATC CAGTGCAGAC ATAATCAAAA  CATATCACCA CCGCCAAGGT CAGGTTCTAT CATGTTCTGG AAAAGATACC TGCTGAGAGG CCACTGCCTG TCACCTTGCC CCACAGACCT CATCCTGGAA ACTTCTCATT TCATCTTCCC  TTCTTTGACC ACTAGATGGA ATATTTTCAC TTCTATTCAC TGAAACCCTG AAGGGACAGT TTTCCAAACT GGACACACTG CTTGAGAAGC CCAATGCTGA AGGGAAAATG TTTTTCCTTT  AATTGTTCTG CTTACCCTAA CCATTTTCTA AGCACTTGCA TCATATGAGA GTGAATGTGG AATAGATGTT TAGGATCCCC ACTTTCTGAC CTTCAACTAA ACCTGTCAAC AACAGTGCTT  TATTTCAAAA GGGTAACCTG AGTATTACAG TGGGAATCCC CTGACACCTT TCTGCAGGGC CTTCTGCTAA CTTAAGGCTA CCCTTACCTT CACTCTTGAA ACCTCAAGCC TTTCAGATTC 
CTGCTCTTAA AGTCAACAGC TGGGGTATGA ATTATTATGG GGCAGGACCA TGTACTGATT TTAGAGCAGT AACTGCAGAC 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCGTCTGGAA CCACAGCAGC TTCAACTTCC TCCACACACT TCCTTCTGTG GGAAGGTGAC CAGCACAAAC CCGCTCTGAA AAGTCTTGGG GACCAAATCT CTGTCTGAGA GGAAGGTAGG  TGCAGTTCAT CCACTAAGTT TATCCACCTG TTCTGTGACT CCTCTTCACC ATTCTCCCAG CAACGACTGA GCCTCATGAC TTGGGGGCTG GGGGATGAGG TGGAGGTGGG GGATATAATA  TAGGAGATGG TACAGTGCAG GGGCAGAGGC TGGTGTGTTC TCCAGGACAA GTGGCACCAC GCACTGAAAG ACTTTTCAAG ATAAACACAA CTTTGTCTCT TCAGCCTGGC AAGAGCTGAG  GCACTGAAAA CTTCTTTTTT CCCCTAGAAA ATGACACACT CTCCTCCTAA GGGTCCCTTT GATTTTGTCC TGGTGGAAAG CAACAAAGAG AAGAACGTGA ACAGGAATAT GTATATTTCA  GTTGTCATCT GAGTCCCATG GATAGGAGGC TCAATTCTCT TCTTCATCTT TCAGATCTCC GCAGACCCTG CCCTCTCACT GTACAATTCA GAGATTGACA CTCAGCAGGC ATTCAATAAA  CGTCTGTGTC AAATGAGAAC AACTTGATGG GGCAAGTAGG AGTCAATCCT GCATCCCTCC CTCCCTTTTT TTCCTCTCCA TTCGACCTTT AGGGCTCTGG TTTCCTGTAA GCAGTGAATT  ATTTACCTCT GCTCATAGAT ATCAAATTGG CCCTTCCCAG GTTGCAGCAG GGTGGGGCGG GGAGGCGGCC TTGTTCAGTC TGTTAATAGG AGGAGCAACC TCCTTGTTCA AACAGCACTT  ACAGGTGGGG ACCTGTTTTT GCTAAGTCAT CCTGGGGATG CTCAAAGCTC CATTGTTAGA TCCTTTCTGT CCTCCTTCCT GGCTCCTCCT TCCTCCCCAC CCCTCTAATA GGCTCATAAG 
TGGGCTCAGG CCTCTCTGCG GGGCTCACTC TGCGCTTCAC 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCATTGCCAAGTCCTTCTATGACCTCAGTGCCATCAGCCTGGATGGGGAGAAGGTAGATTTCAATACGTTCCGGGGCAGGGCCGTGCTGATTGAGAATGTGGCTTCGCTCTGA
GGCACAACCACCCGGGACTTCACCCAGCTCAACGAGCTGCAATGCCGCTTTCCCAGGCGCCTGGTGGTCCTTGGCTTCCCTTGCAACCAATTTGGACATCAG
GTGAGGGGTCCCTCCTTG
TAATGCACCAAAAGTGTTGGGTTGGTGTAGCTCAGGTGGGATAAAAGGAGAGGCTGAATGACCATGTTTTGGAGTGTCTGGAATAATGGGGTATGTTTTGTTAAGCTAGGTCTTTAGGTG
CATGTGACATACCAAGAGAAGGTATATATTTTTTAAGATTAAACACTGAGGCTGTGTGATTTTTATAGTTTACTGTCTTTCTACTATATTACTCCATGAGGGCTGGTTCCAGGTCTGTGT
TTCTCTCCACTGTGTCCTCAGTGCCTAGGGCACAGAAAGCACTCATTAAATATTTGTTGAATAAATGAGTGGAGAAAGTAGAGGCCAGGAATCAAACAAGAATTGGACAGACTCAAGAGA
CCTTAGCTCTAGCTGGACTTGGTTTTGCTATTTAATGGCTCTGTGCCCTCGGAAAGGGCGCTTCATTTTTCGGTTTAGTTTCCTCATCTGTAAATTGGGGATAATACCACTTAGCTCATA
GGATTATTATGATGTTTAGGGGACAGGATATACAAAAGTAACTTGAAAAATATAAAGTACTATGCAAATGCAAGCAAACTGTTATTTAGATTGAGGATGATTTTTGTTGGTTTAAATTAG
CCAAGTGGAAAGAAAATAAGCAGGAAAGAGAAAGGTTTTCAAAAGGCACGTGCCTCTGGGCATTACATGCACCTATTTCTGATTAATGGGTCAAGCTGTTATAGATCTTCAGCCCACACA
CCTCGAGTTCTCTTTTAGGGATTCTTCTATTTCCACCTATGATTTTAACGTACAAGCAGGGAGAATGAACCCAAGCGAACCCTCTCGTTATAATCCCCTTAGTTCAATTCACAGTGGTAT
GAAGGTGAGGAAGACAGGAAAGCAGGAAGGCTGAAGCATCACTGGCTGTGACAAACCTGAGCCCAAACTGTTCACTGCTCTCACTGTTCTTCCCTAAGTTTTCTGTCTGGCCTTTTCTAG
AGCAGGAGAGACAGAAGTAGCAAACCCTCTTTCGAGATGTCCCTCCAGCCCCAGAAGTACCTCCAGCCTCACACCATCTCTTCAGCCTAGCAAGTTGCTGGAGGGAGTCTATAACCTACC
AGGAGCCAGCCAGCCATTTGTATCAAGAAATAGAAATCTGCCAGGGTACAGTGGCTCACACCTATAATCCCAGCGCTTTGGGAGGCTAAGGTAGGCAGATTGCTTGAGCTCAGGAGTTCA
AGATTAGCCTGAGCAACATGGTGAAACCTTGTTTCTACAAAAAATTGCAAAAATTAGCCAGGCATGGTGGCATGTGCCTGTAGTCACAGCTACTTGGGACGCTGAAGTAGCAGGATCGCC
TGAGCCTGGGAAGTCGAGGCTGCAGTGAGCTATGATTGTGCCACCGCACCCCAGCCTAGGTGACAGAGTGAGGCCCTGTCTCAGGAAAAAAAACAGAAACAAAAACAGAGAAGTCCACTA
GAGATCAGCTCTGGGCTCATGATGTCATGATGGCCTGGAACTGACTGAACTAGTTAGTTCTCACAGGTCAGAAGCAGGAACTTTCTCCCAGAGGAAGGTATCTGTCTGTTAAATTGGAAA
GGTAGAGGTGGAAAAGAAGGGTTCCCATAGGCCTTTTGGATTGTCATGAATGGTGATGCTGAGAGGGAATAGGACAGGGATGGCAGTGGGGAGGGAAAGGCAGGGACCAGGTTTTGAGCC
AAAGCATGCGTAGCTGAGAGCAGTGAGTGGATAGGAGGTGCAGCAGTCTTTGGGTAGCAGCCTACTCAAGAAAAGAATGATAATTACATACTCACAATCTTTAGCCATCAAGCACTTATT
TCCTCAACTCCCCCTCCCCCTGGCCTATTGCCAAACCCTAAATCCTGTATCCTATTTACTTCATGCCTGTTGGTTACTAAGTAGTTCCATTTAGAGTACACATTCATTGTTGCCTTGAAC
TTGCTCTGCTGTTATGGCACCTGAAAACTAGATGTTCTTGGATGGGGGTCTTCCTTCATCAAAGCTTCTTCCCATTTGTACTTCAGTTCTAGGACAAGGCAAGAAGAAAGCAAGAAGCTG
TAAATCCCATTCCTCTGGGTCTCAATTTCACCCTCAGTTCAAGGAGCTGAGTAGGCAGAGGCAAAGGCTATACTCAACACACGTGCAATTGAAAGCAGGCGAGGCAAAACCAGGGCAGAG
GAAAGGAAAGGGGTGTGTGTGTAGGTATGGATTTATGGGTAGGTGGGTCGGTAGGTTAGTTGAAGAGGAGGTTCTAAGCAGTATAACCTAAGCCTCTTTTCTCTTTCTTCTGCTTCAAAC
ACCTTAAGAACTGCTCAGGGTAGACTGGAGACAAAAGCAACAGCTCAGAAGTGCTAAATCTTGAAGAGCAGCCAAAGCATGGGCAACAAAGTGAGACCCCATCTCTACAAAAAAAAAAAA
AAATTAGCCGGGCATGGTGGCCTGTGTCTGTAGTCTCAGCTACTAAAGAGGCTGAAGCAGGAGGAATGCTTGAGCCCAGAAGTTCAAGGCTGCAGTGAGCAACACCTCGTCTGTCTTGTC
TCTCTCTCTTTCACAGTGAAAAAGAATGACCCTGGGGAGGGAGTGTAGGAGGGTGAAAGAGTTTCATGTTGTGGATCTTTCTCTTCCCCCACCCACTGTCCACGCACTTTGTCTTTTTCC
TCCCCTAGGAGAACTGTCAGAATGAGGAGATCCTGAACAGTCTCAAGTATGTCCGTCCTGGGGGTGGATACCAGCCCACCTTCACCCTTGTCCAAAAATGTGAGGTGAATGGGCAGAACG
AGCATCCTGTCTTCGCCTACCTGAAGGACAAGCTCCCCTACCCTTATGATGACCCATTTTCCCTCATGACCGATCCCAAGCTCATCATTTGGAGCCCTGTGCGCCGCTCAGATGTGGCCT
GGAACTTTGAGAAGTTCCTCATAGGGCCGGAGGGAGAGCCCTTCCGACGCTACAGCCGCACCTTCCCAACCATCAACATTGAGCCTGACATCAAGCGCCTCCTTAAAGTTGCCATA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCATTGCCAAGTCCTTCTATGACCTCAGTGCCATCAGCCTGGATGGGGAGAAGGTAGATTTCAATACGTTCCGGGGCAGGGCCGTGCTGATTGAGAATGTGGCTTCGCTCTGA
GGCACAACCACCCGGGACTTCACCCAGCTCAACGAGCTGCAATGCCGCTTTCCCAGGCGCCTGGTGGTCCTTGGCTTCCCTTGCAACCAATTTGGACATCAG
GAGAACTGTCAGAATGAG
GAGATCCTGAACAGTCTCAAGTATGTCCGTCCTGGGGGTGGATACCAGCCCACCTTCACCCTTGTCCAAAAATGTGAGGTGAATGGGCAGAACGAGCATCCTGTCTTCGCCTACCTGAAG
GACAAGCTCCCCTACCCTTATGATGACCCATTTTCCCTCATGACCGATCCCAAGCTCATCATTTGGAGCCCTGTGCGCCGCTCAGATGTGGCCTGGAACTTTGAGAAGTTCCTCATAGGG
CCGGAGGGAGAGCCCTTCCGACGCTACAGCCGCACCTTCCCAACCATCAACATTGAGCCTGACATCAAGCGCCTCCTTAAAGTTGCCATA

Retrieve as FASTA