Entry information : HsGPx04-C
Entry ID 3633
Creation 2006-08-23 (Christophe Dunand)
Last sequence changes 2016-06-28 (Harold Duruflé)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-06-28 (Harold Duruflé)
Peroxidase information: HsGPx04-C
Name HsGPx04-C
Class Animal glutathione peroxidase     [Orthogroup: Gpx1002]*
Taxonomy Eukaryota Metazoa Chordata Mammalia Hominidae Homo
Organism Homo sapiens (human)    [TaxId: 9606 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HsGPx04-C
start..stop
S start..stop
PtroGPx04 358 7e-128 66..234 29..197
HsGPx04-A 358 7e-128 66..234 29..197
MnemGPx04 358 9e-128 66..234 29..197
MmulGPx04 358 9e-128 66..234 29..197
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..195 195 N° 2 452..546 95 N° 3 632..776 145 N° 4 924..1075 152
N° 5 1508..1532 25 N° 6 1666..1725 60 N° 7 1806..1838 33  
join(1..195,452..546,632..776,924..1075,1508..1532,1666..1725,1806..1838)


exon

Literature and cross-references HsGPx04-C
Literature Oh,J.H., Yang,J.O., Hahn,Y., Kim,M.R., Byun,S.S., Jeon,Y.J., Kim,J.M., Song,K.S., Noh,S.M., Kim,S., Yoo,H.S., Kim,Y.S. and Kim,N.S. Transcriptome analysis of human gastric cancer. Mamm. Genome 16 (12), 942-954 (2005)
Protein ref. UniProtKB:   P36969
DNA ref. GenBank:   NC_000019.9 (1104734..1106568)
mRNA ref. GenBank:   NM_001039848
Cluster/Prediction ref. Genebank:   2879 UniGene:   Hs.433951
Protein sequence: HsGPx04-C
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   234
PWM (Da):   %s   26783.67  
PI (pH):   %s   10.75
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRAGAGSPGRRRQRCQSRGRRRPRAPRRRKAPACRRRRARRRRKKPCPRSLRPEIHECPKSQDPCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQ*GKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF*

Retrieve as FASTA  
Remarks This variant (3) contains a different exon for the 5' UTR and 5' coding region, compared to variant 1. The encoded isoform (C) is longer and has a distinct N-terminus, compared to isoform A (HsGPx04-A).
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATTTTCTGAG CACATACCGC GCGTCCCTGC GTGGGCAGCT GCCCCTGGGG GTGGGAGCCC AGGAAACTCC AGGTTCTCAG TTAAGTGGTA ACTGTCTTGA TGACTCTCAG GTCTCAGTGC  CCACATTATA CAAGCGGCTC AGCAACCAGA CCCAGGATGG GGAGTCACTG ACCCCCTGCG CCCATGGCAG GGGTGAGGGT AGGGACACCC CCATAAGATG GAGCTGTGAT GAGAAGCAAA  CCCAACTCAG TTTGGTTTCA TTTACATTAA AAAGGCAAAT CCCTTGGCCG GATGCGGTGG CTCACACCTG TAATCCCAGC ACTCTGGGAG GCCTAGGCGG GCAGATCACC TGAGGTCAGG  AGTTCGAGAT CAGCCTGGCC AACATGGTGA AACCCCGTCT CTACTAAAAA TACAAAAAAA TTAGCTGGGT GTGGTGGCTC GCTCGTGTAA TCCCAGCTAC TCAGGAGGCT GAGTCAGGAG  AATCGCTTGA ACCCGGGGGC TGGGTGGAGG TTGCAGTGAG CTGAGATAGC GCCACTGCAC TCCAGCCTGG GCAAAAGAGC AAAAAAACTG TGTCTCGGAA AAAAAAAAAA AAAAAAGGCA  AATCCCGGCC GAGCCTTTGG CTCACGCATG TGATCCCAGC ACTTTTGGGA AGCTGAGGCT GGAGGATCAC TTGAGGTCAG AAGTTTGAGA CCAGCCTAGG CAACATAGCG AGACCCCCAT  GTCTACAAAA CAATAATTAG CCAGGAATGG TGGATGAGCC TGTTGTCCCA GCTACTCGGG AAGCAGAGAC GGGAGGTTCG CTTGAGCCTG GGAGGTCGAG GCTGCAGTGT GCCCTGATCG  TGCCACTGCA CGTTAGCCTG GGCAACACAG CAAGACCCCG TGTCTTAAAA AAAAAAAGGT AAATAAGAGT TGGGGACACT TTTCTGCGAG TTGGAGAAAC CAAACCCCCT CGACGAGTCT  TAAGTAGTAT TCTCAGGTTG TCTGGCCTGC GGCCGCGCTG CTGTCAACCA GCCGGATAAC TGCGCTGCCT CCCGACGCGC CGCCAGCCAG GCCACGGCCT CCTAGACACA AGCGAGCATG  CGCAGTCGCC AACAACAAGT CCGCACGTCC GGTCCCGCCC CCCCTTCCCC GCCTTCTTCC CACTCCGGCC TCCCATTGGC TGACGTCGGC GCGAGCGCTC AACACCGACG CGTCTGACCA  ATGAGCGCTC TGGAGGGCGT GGCCGTGGGA AAGGAGGCGC GGAAAGCCGA CGCGCGTCCA TTGGTCGGCT GGACGAGGGG AGGAGCCGCT GGCTCCCAGC CCCGCCGCGA TGAGCCTCGG  CCGCCTTTGC CGCCTACTGA AGCCGGCGCT GCTCTGTGGG GCTCTGGCCG CGCCTGGCCT GGCCGGGACC ATGGTGAGCT AGCGCCGCGG CCGTTGCCGG CCCGGTGACC GTTGGGGCGG  GCGCGCGATC CCTGCCTCCG CTCGCCGGCG TGGGGAACCC TCAGGCTCCA GTGACCTTGG TGGGGGGCGT CTGGGGGCTC CCCCTCCCCA CCCCCGGCCG GGCACGGACG CGGGTGACCG  TACTGCGACG CGCTCCGCGG CCCTCCAGGC CGTTGTAGGC GCGCGGGCTG GGGTCGGGGA AGGGGAAGGG GTTGTTCCAC GCGCGCGGGT CGTGGTCGGG GAAGGGGCCG TCCAGGCCGT  TGCAGGCGCG CGTGCCGGGG CCGGGGTCGG GGGTCCAGGC TTGCAGGGGG CGGGGTCCGG GACGGCTGGG GCGGAGCTGG ACCGTTGAGG GCCACGGCGG GGCGTCTCCG GGCCGAGCGG  GGCTGCTGCG CCCGAGCGGT TGGGGGCGCG GAGGGCTGGA AATCCCGGAT CACGCGCCCC CGGGCGCCGC CCCGCCCCCG CACCTTGGCC TAGCGCGGTG GCGTCACAGT CGCGCAGTCC 
TGACTACGGC CTCCGGGCCC TTTGTCCCCG CTAGCGGCGC TCGGGGTGGG GGAGCCAGGA GGGGCGGGAG ACGGGCGGGT 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTCCACAAGT GTGTGGCCCC GCCCGAGCCC CTGCCCACGC CCTTGGAGCC TTCCACCGGC ACTCATGACG GCCTGCCTGC AAACCTGCTG GTGGGGCAGA CCCGAAAATC CAGCGTGCAC  CCCGCCGGAG GAAGGTCCCA TGGCCTGCTG GGCTTGGCTC GGCGCCCCCA CCCCTGGCTA CCTTGTGGGA ATAAACAGAC AAATTAGCCT GCTGGATCTT TCTGCGTAGG GGCTTGGGGG  GCCCTTTTGC CAGGGGCCCC TCCATGTCAG GGCCAGTTGC CGTCAGCTGC CAGGCTGGGG GTGCCATGGA GGTGGCGTGT TGTTGCCCCC TCTTCCTCCA GGCTCGGGGG GCTGTGCTGG  CTGCAGTGCT GGGGTGCAGT GAGATCTGGG CCCGTTGGAC ACCCAGCCCT GGCTCTTAAT CCGTGCAGCC CCACCTGCTG TGCACAGGCA GGGCCTGGTG TAGTGCCGAG TCTTGGAGGA  GATAATTCTA AGTGGCTGTG CTTCCTGGCC CCGGGCCTTA ACTGTTAGGA GGTGGCTACT GGGGCCTCCC CTGGCCAGGA AGCAGAAGTG CAGAGGCCCG AGGAACAGCG TGGCCCTGGT  GCTGGGGATG GGTTGGGCAC CCACACCGGC CCTTGGGGCC TCACCTGGCT GGGGGGTGTG GGGGTGGCTG GGTGGTTACT GTTTGCACAG AGTCCCTCCG TGAGGGCTGG GGATGGACAG  GCCAGGAGGG GCTGGTAGAG CAGTACCAGC CACCGTTCAT GGGACCCGGG GGCTGTCTGG ACACGGCCTG GCTGCCCACC TGCACAGCTA GAGGGACTGC AGCCTGCCAG GGTGGCTGAT  CCCAGCTGCC CCCACTGGGG GTCTGTGGAA TGGACGGTCC ATGGCACCTG CCCCAGACAC TGGGTTGAGA GGTCTGTCTC TCCCAGCCCT CGTCCCCTCT CATCCACATG GGGCCAGCAC 
AGGCAGTGGG CAGAAAGGCC TGGTAACCAG GAGAGCCTGG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCCGCGCGGGCGCAGGCTCCCCCGGGCGCCGCAGGCAGCGGTGCCAGAGCCGGGGCAGGCGGCGGCCGCGAGCCCCTCGGCGGCGGAAGGCCCCAGCGTGCAGGCGCAGGAGGGCG
CGGCGCCGGCGGAAGAAGCCCTGTCCCCGCAGCTTGCGACCGGAGATCCACGAATGTCCCAAGTCCCAGGACCCG
GTGCGCGCGGGGCCCCCACACCGGCTAATGTGGCACATTTTGGGG
TTGGAACCCTCTCCCGGCCTCCGGGTCTCCGGTAAAACCGGACCAGAAGTACAAGGGGGCGTGTGCGTTTAAGGAGGAGGAGCGTTCAGGTCTTCAGGGCCGCAGGGCCTCGGTGTCCCC
GCCACCGACCCGCTCCCGATCCCTTCCTGCCTCAGGGTCCCGGGCTCAGCCTCCCGTCCACGCTCCCTGCTCAGCTTCCTTTGCCTTGCAGTGCGCGTCCCGGGACGACTGGCGCTGTGC
GCGCTCCATGCACGAGTTTTCCGCCAAGGACATCGACGGGCACATGGTTAACCTGGACAAGTACCG
GTGGGCGCTCGCCTGGGGTGGGGCGCGGGGTCGGGCCCTGGGAGGGGGCCGTGT
TCTTCTGCGCTGACGCCGCCGATCCTCGCAGGGGCTTCGTGTGCATCGTCACCAACGTGGCCTCCCAGTGAGGCAAGACCGAAGTAAACTACACTCAGCTCGTCGACCTGCACGCCCGAT
ACGCTGAGTGTGGTTTGCGGATCCTGGCCTTCCCGTGTAACCAGTTCGGGAAGCAG
GTGGGCTGCTGCGTCCCCGGGGCCCGCAGAGGCGGGTGGGTGGGGGTCGGGGTGGGCTCCAGCC
TGGAGAGGGCCTGGGAGTGTGCAGGGGGCCCGGACTGAGGGGGTGCCAGCCCCCGACTCACTCACACACCTTGGCCGCCACAGGAGCCAGGGAGTAACGAAGAGATCAAAGAGTTCGCCG
CGGGCTACAACGTCAAATTCGATATGTTCAGCAAGATCTGCGTGAACGGGGACGACGCCCACCCGCTGTGGAAGTGGATGAAGATCCAACCCAAGGGCAAGGGCATCCTGGGAAA
GTGCG
TGACCTCTGGGGACAGTACGGCTGCTGGGGTGGGGGTGGGGGGGCTGCTGGGATGCTCACACCTCCCTGGGGCAGAATGGCTCATGGCTCGGGGGGCGGTTGCGGGGAGGTGCTGGGACT
CTCACATCGCGTGGCCTCCTGGGGGTAAGATGGCTCAGGGGGACATAGAGGGCTGTGGAGGCAGCCAGGGATGCCCACACCTTTGTGGCCTCCTGGGGACAGGATGGCTCGGGGGCCTGT
GGGGGGCTGTTGGGACTCTCACACTGCATGGCCTCCTGGGGTAAGATGGCTCTGGGGGGGCTTGGGGGCACTGTGGCTGTGGAGGCAGCCGGGGAAGCTCACACCCTTGTGGCCTCCTGG
AGACAGGACAGCTTGGGGACTGTGGGGGGCTGCTGGGGACGCTCACGTCCATGTGCTTCTTTTCCAGTGCCATCAAGTGGAACTTCACCAAGGTAAGGGGGCTGTGGGGGGTAGGGGACC
AGCTTCCCCTGGCCACAGCCGTGGCCCAGATGGGCAGCGGACAGGAAGGGCAGCCTCAGCCCCTTGCAGGGGTGGCCCCACAGTTTGGACACCGTCTCTCCACAGTTCCTCATCGACAAG
AACGGCTGCGTGGTGAAGCGCTACGGACCCATGGAGGAGCCCCTG
GTAGGTCCTCTCTAGGGAGCCCGCTTGAGGCTCGGGGGCTTGGGAGGTAGCTGCCCTAACCCAGCTTTCCTCCCC
GACAGGTGATAGAGAAGGACCTGCCCCACTATTTCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCCGCGCGGGCGCAGGCTCCCCCGGGCGCCGCAGGCAGCGGTGCCAGAGCCGGGGCAGGCGGCGGCCGCGAGCCCCTCGGCGGCGGAAGGCCCCAGCGTGCAGGCGCAGGAGGGCG
CGGCGCCGGCGGAAGAAGCCCTGTCCCCGCAGCTTGCGACCGGAGATCCACGAATGTCCCAAGTCCCAGGACCCG
TGCGCGTCCCGGGACGACTGGCGCTGTGCGCGCTCCATGCACGAG
TTTTCCGCCAAGGACATCGACGGGCACATGGTTAACCTGGACAAGTACCG
GGGCTTCGTGTGCATCGTCACCAACGTGGCCTCCCAGTGAGGCAAGACCGAAGTAAACTACACTCAGCTC
GTCGACCTGCACGCCCGATACGCTGAGTGTGGTTTGCGGATCCTGGCCTTCCCGTGTAACCAGTTCGGGAAGCAG
GAGCCAGGGAGTAACGAAGAGATCAAAGAGTTCGCCGCGGGCTAC
AACGTCAAATTCGATATGTTCAGCAAGATCTGCGTGAACGGGGACGACGCCCACCCGCTGTGGAAGTGGATGAAGATCCAACCCAAGGGCAAGGGCATCCTGGGAAA
TGCCATCAAGTGG
AACTTCACCAAG
TTCCTCATCGACAAGAACGGCTGCGTGGTGAAGCGCTACGGACCCATGGAGGAGCCCCTGGTGATAGAGAAGGACCTGCCCCACTATTTCTAG

Retrieve as FASTA