Entry information : MtPrx46 (Medtr5g021060.1[4.0] / Medtr5g021060.2[3.5] / Medtr5g020980.1[3.0])
Entry ID 370
Creation 2006-01-31 (Christophe Dunand)
Last sequence changes 2010-09-16 (Haythem Mhadhbi)
Sequence status complete
Reviewer Harold Duruflé
Last annotation changes 2016-06-17 (Harold Duruflé)
Peroxidase information: MtPrx46 (Medtr5g021060.1[4.0] / Medtr5g021060.2[3.5] / Medtr5g020980.1[3.0])
Name (synonym) MtPrx46 (Medtr5g021060.1[4.0] / Medtr5g021060.2[3.5] / Medtr5g020980.1[3.0])
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Flowers
Immature pods
Leaves
Root tips
Roots
Seedling roots
Inducers Colletotrichum inoculation
Dark growth
Elicitor treatment (glucan, oligosaccharides, yeast extract, Phytophthora crude extract)
Nitrogen starvation
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx46
start..stop
S start..stop
GmPrx33 608 0 1..330 1..330
GmPrx102 597 0 1..330 1..330
EglPrx137 564 0 1..330 5..335
EgrPrx137 564 0 1..330 1..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8078357..8078581 225 N° 2 8078909..8079100 192 N° 3 8079189..8079354 166 N° 4 8079576..8079988 413
join(8078357..8078581,8078909..8079100,8079189..8079354,8079576..8079988)


exon

Literature and cross-references MtPrx46 (Medtr5g021060.1[4.0] / Medtr5g021060.2[3.5] / Medtr5g020980.1[3.0])
Literature Watson,B.S. et al., unpublished.
DNA ref. Phytozome 11:   chr5 (8078357..8079988)
Cluster/Prediction ref. Phytozome Gene 11:   31087483
Omic ref. Gene atlas:   Mtr.10969.1.S1_at Legoo:   Mtr.10969.1.S1_at
Protein sequence: MtPrx46 (Medtr5g021060.1[4.0] / Medtr5g021060.2[3.5] / Medtr5g020980.1[3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (309)
PWM (Da):   %s   36494.68 (34029.5)  
PI (pH):   %s   8.86 (9.21) Peptide Signal:   %s   cut: 23 range:23-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVNSINFLLLFSLLVFAPCCHCKTKLGDYLYPQFYDESCPKVEEIVKSVVAKAVTKEPRMAASLLRLHFHDCFVKGCDASVLLDSSGTIISEKRSNPNRNSARGFEVIEEIKSAVEKECPQTVSCADILTLAARDSTVLTGGPSWDVPLGRRDSLGASISGSNNNIPAPNNTFQTILTKFKLKGLNIVDLVALSGSHTIGDSRCTSFRQRLYNQTGNGKSDFTLDQNYAAQLRTRCPRSGGDQNLFVLDFVTPVKFDNNYYKNLLANKGLLSSDEILLTKNQVSADLVKKYAESNDLFFEQFAKSMVKMGNITPLTGSRGEIRKRCRKINN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, 3 introns) and 9 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCTTTTGTGT CTCTCAAACA CTCTCACATG GAAGTGGTAC AATGTATGTA TAGAGAAAAG GGTGTTCATG AAACATTATC CTCTTGTTAA ATTGAAAAGT ACTTTTGAAA ATATAAGAAT  AAGAGCATGG TTAAAAAATG TGGGGCTGAT TGATTATAAT AATATCAAAC CTCCTAAACA AGTCACAAGG CATGGCCAAA GTTTTTCATG TGAGAGAGTG TCACCTTTGT CTTGAAGGGT  ATATTTGTGG TCCTAGAATA GGGAACTTGG TAGACTTAAT TGTTAAAGTA AAAGCTCCTT GAGAGCATTA TTAAGGGAGA ATAAATTAAA GACTAAGCAT TCACTTGTCA CAAAAAAATA  TAAACATGTA ACTTTATAGA TTCTTATTTG AAAAATGTTG CATGGATTTA TATGCAAGGA TCCCCGGTGA TCTTTTATAG ATTTAAAGTT AATTGCCACG TTCCTATACT CATATTTTAT  CTTAAAAAAA TTGCCATAAA GAAAATAAAT AGAAGAAGTG ATTCCAGCTA ATTTAATCAC TTATTTTTTT AGAATCTCAG TTTACTATAG TCAAGGTTGT CGTTTACCTG GAGTCTAGAA  TCAAAGCTAA GCATATACTA TAATACAATA TTATTCAAAA ATATTATACT CCAAAAAAAA AAATGAAAAG AAATAAAGTT GTGAATATAA TGCTAAATTA ACCAAGAGAA GAAGACACCT  AGCTTAGTAG GTATCCATTC ATACCTGTTC CTTAAGTAAA AATATTCATG AGCTACAATC AAATAAATTG AGCAGTTGAG TCTACCTTAA CTTTGTAGAC TGCCTCTAAT AAGACACACA  GAACAAGAAC TGCATAACAA CTGCCCCACT ATTTCATAGC CTCTGTTCCA AATTATAACT TGTTTTAGTA AGAAATAAAT TGTTTTAAAT TGTAAGTCGT TTTACAATAT CAATAAAATA  TTAATGTTAT TTTTTCTATT ATATCTTTTA TTGTTTATTA CTCTTTTTTC TTTAAAAAAA TTAATTTATA TTTCTAATAT CATTTATTAA GGATAACTTT ATAAAATAAT TCATAATTTT  TCTTTCTCAT ACAAAATTAT TTACATTTCT TAATACAGAT AACATCATAG TTGACTGGAA GCCCTCTACA ATCAAAATTA ACTTGTAGCT AATATAGTAT CGACACTTTA TATTAAAGGT  GTGTTTGATG ACTGACACGC GTCGGTGTCC AACAATGACA AACACCGATC TAGTATGTTT GATATTTGTG TCGGTGCTTG ATAGGTTATT GCACAAATAG TATCTAAGCT CCAATTGGGT  TGGCTTGGTT AACTGAAAAA CAGCTAGTGA AATAGTCTTA AACATTTATC AAAAATTACA CATCAATGTC CAACCAATTA ATTAGGCTCA ATCATTGTTT GGTCGAATGA TAAAGCAAAA  GTAATATAAC ATTTAAGAAA CATCAAAAGA AAGGAATTGA TTCAGACGTT TTTTTAACTA AACAAATAAA AAGATTAACT GTTGTCTTAC AATGCAAGCA AGAATAGGAT AAAAATGCTT  TACACATTCT TTTATTTAAT TAACGTGTGG TGAACTTAGT CCAGTTGTTC ATTAAGGCTT TTAGCTATAT AAGTATATTG CTTAATATAC CAAACTAAAA GCATGTTTCA CTGCATTTAG  AAATTGATTT AGACCCTTAA GCTACTTCCA TACAACAATA TGGGTGATTT TACATGACAT AGTAAAAGCT AACAACTCTT ATCTTATCAT TTTATATGAA ATTGAAAATT AGTTATGTAC  CAACTCCAAC TTTTTTTCCC CTCTCATAGA CACTTTTTCC TTTTGGTTTT CTGTCATGCA ATACTTTTTT GCTATATTGA TTCTTCTCTA TAAATACTAT TATTTCCACC ATGGTGTTCA 
TCCAATACAG TTGAAAACAC CTCTTTAACT ATTCTTTCAT AATAAACTTT GTTCTGTGAA GTGATCTTGA AAGAGAAATA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAAGTACTA TCGTTGTCAT GTTGCACATG TGAAATTGCA TTCTACATTT GTTGATCTTT TGTTTATTTA GCCATTTTTT TTTTATGAAG CCATTGGCAT AGTCGCTGTG TCCTGAGTAT  AAAATTTGGG CTTTTGGTAG CATTGTTGTG TGTTTGAAGA AATTCTATGT AATAAGATGT TTCAAAAATT GGTTAATAAA GTGCGAAGTT GTTGAAATTA ATGGTCTTGA AGTTTTAATG  AAATTTATGT CCTAAAGTGA TTTTGGAAAA CTAAGGATGC TTGCCGTCAT CTTATATTTT GGATGCTGTA TTTTCTTCTG AAAGTTATTA TGAATCTTAT AGACGATGTA TCCAAAATCA  CATGATTATG GTTTGATGAG GTTGCAATAA TATGATGATG ATTGCTTTCT TTCCTGACCA GATCTGGGAA CACATTTGTG TGTATAAAAA TGTGAAACAG AGATACATCA TGTAATGTGC  ATGGCAATGA ACCTGGTTTT TATTAGTTGC ATGTTAGCAA ATTTGTATTT CATCAAATTT GAAAAATAAG GCCAATGAAA GTTATACTCA AAATGGTTGA GGACTTTACC AGATACCAAG  TAATTAGTGC ACGTACTGTG CTAGATAGAA TTGGAAAAGC TCGAGTGCTT GCTCGACAAA TGATTGATGT TGCACAAGTT CTCAAACAAC AATGGTCACT CTAGAGTTTG TGGAAGATAA  CAACTAAATA CATCTAGGAT TGACACAATT TTTATTGGAC TTGCTTGATA TTGCAATTTT TTGCCCTTTC CTTAACAATA CTTCAAGTTG GACAAATGAT ATTTCATGTT TTTAGTATAT  ATGCAGTGCA CGTACAAAGT AAAAACTAAC AGCACTTTAT AAAGACTGCA GTTTAAGTTC AAGTGCACAG AGCAAAGTAC TTTCTGCTAG TGAAGTATTA GACTATAGTT AGTTAGAGTG 
TTTGAGAAGC TTGGTTAAGA GTTAGTTACA CAACTAAACT 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCAATTCTATAAACTTTCTCCTGCTTTTTTCTCTACTAGTCTTTGCTCCCTGCTGTCACTGTAAAACGAAACTAGGAGACTACCTCTACCCTCAATTTTACGACGAATCATGTCCT
AAAGTTGAAGAGATTGTCAAGTCCGTAGTTGCTAAGGCTGTCACTAAAGAACCCCGCATGGCTGCTTCTTTGCTGAGACTACATTTCCATGACTGTTTTGTCAAG
GTCTCTGCAATTTAG
TAAACAATGTTTAAAAATGCGGTCATGATCGTCATCTTTTATATATTGCAGAAAATTACGTTTCAATACTGCTGATATGGTTGCAGTTGTAGTCACGACATGGTCAGAGACATAAACAAC
CTTAACATTGTGACCACAATTGCAGTCACATACTATTTTTCCAACCATTACTTGTGAATGCAAATAGAAAATTTACAGTAGTGTCTAACTATATATGTGATCTATGAGTTGCATATTAGG
TCTTGGTGATATGCATGGCCATATTTATAGAATTTAAATTGTTCAAATGCATGACAAAAGTTGATTTTGCAGGGTTGTGATGCATCGGTGTTGCTAGATAGCAGTGGAACAATCATCAGC
GAAAAGCGGTCAAATCCAAACCGTAATTCAGCTAGAGGATTTGAAGTAATTGAAGAAATTAAATCCGCCGTAGAGAAAGAGTGTCCCCAGACAGTCTCTTGTGCTGATATTTTGACTCTT
GCTGCTAGAGATTCAACTGTTCTT
GTAAATATTTTCTCTTGTTTTCCACTTTATTACCCTTATCAATGACCATCAAAAGTTAAATATCAAGTCTAATATTCAATCCTTTCAGACTGGTGG
ACCAAGTTGGGATGTACCTTTGGGAAGAAGGGATTCTCTTGGTGCAAGCATAAGTGGCTCAAACAACAACATTCCTGCCCCAAACAATACATTCCAAACCATCTTAACAAAATTCAAGCT
TAAGGGACTTAACATTGTTGATCTAGTTGCTCTATCTG
GTAAACTCCTAGTACTAATCTATTTCATCTCCATTGTTTTCAGCACATACTTGGTTTATTCTATCGAGTCTCATAGGCATAA
TATAGTTGATGAAGCCGCGATTGTGCAGTTGTATATTATCCTCATGCATCAACAAAATTTATCTCAATTTTCCTCATTTTAGTATTGGATTCTTCCAAAGTTGCATCAGTGACATAAACA
AATTCTTTTAATGTTATAGGTAGCCACACTATAGGAGATTCACGATGCACCAGCTTTAGACAAAGACTCTACAACCAAACTGGGAATGGCAAGTCAGATTTCACTCTTGACCAAAACTAT
GCTGCTCAATTGCGCACTCGGTGCCCAAGATCTGGTGGAGACCAAAATCTATTTGTCCTAGACTTTGTCACACCAGTAAAATTCGACAACAACTACTACAAGAATTTATTGGCCAACAAG
GGTCTCCTAAGTTCTGATGAAATTCTGTTGACAAAGAATCAAGTATCTGCAGATTTAGTGAAAAAGTATGCAGAAAGCAATGATCTTTTCTTTGAGCAATTTGCCAAGTCCATGGTTAAG
ATGGGAAACATTACTCCCTTAACAGGATCAAGGGGTGAAATCAGAAAACGCTGCAGAAAGATTAATAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCAATTCTATAAACTTTCTCCTGCTTTTTTCTCTACTAGTCTTTGCTCCCTGCTGTCACTGTAAAACGAAACTAGGAGACTACCTCTACCCTCAATTTTACGACGAATCATGTCCT
AAAGTTGAAGAGATTGTCAAGTCCGTAGTTGCTAAGGCTGTCACTAAAGAACCCCGCATGGCTGCTTCTTTGCTGAGACTACATTTCCATGACTGTTTTGTCAAG
GGTTGTGATGCATCG
GTGTTGCTAGATAGCAGTGGAACAATCATCAGCGAAAAGCGGTCAAATCCAAACCGTAATTCAGCTAGAGGATTTGAAGTAATTGAAGAAATTAAATCCGCCGTAGAGAAAGAGTGTCCC
CAGACAGTCTCTTGTGCTGATATTTTGACTCTTGCTGCTAGAGATTCAACTGTTCTT
ACTGGTGGACCAAGTTGGGATGTACCTTTGGGAAGAAGGGATTCTCTTGGTGCAAGCATAAGT
GGCTCAAACAACAACATTCCTGCCCCAAACAATACATTCCAAACCATCTTAACAAAATTCAAGCTTAAGGGACTTAACATTGTTGATCTAGTTGCTCTATCTG
GTAGCCACACTATAGGA
GATTCACGATGCACCAGCTTTAGACAAAGACTCTACAACCAAACTGGGAATGGCAAGTCAGATTTCACTCTTGACCAAAACTATGCTGCTCAATTGCGCACTCGGTGCCCAAGATCTGGT
GGAGACCAAAATCTATTTGTCCTAGACTTTGTCACACCAGTAAAATTCGACAACAACTACTACAAGAATTTATTGGCCAACAAGGGTCTCCTAAGTTCTGATGAAATTCTGTTGACAAAG
AATCAAGTATCTGCAGATTTAGTGAAAAAGTATGCAGAAAGCAATGATCTTTTCTTTGAGCAATTTGCCAAGTCCATGGTTAAGATGGGAAACATTACTCCCTTAACAGGATCAAGGGGT
GAAATCAGAAAACGCTGCAGAAAGATTAATAACTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCAATT CTATAAACTT TCTCCTGCTT TTTTCTCTAC TAGTCTTTGC TCCCTGCTGT CACTGTAAAA CGAAACTAGG AGACTACCTC TACCCTCAAT TTTACGACGA ATCATGTCCT  AAAGTTGAAG AGATTGTCAA GTCCGTAGTT GCTAAGGCTG TCACTAAAGA ACCCCGCATG GCTGCTTCTT TGCTGAGACT ACATTTCCAT GACTGTTTTG TCAAGGGTTG TGATGCATCG  GTGTTGCTAG ATAGCAGTGG AACAATCATC AGCGAAAAGC GGTCAAATCC AAACCGTAAT TCAGCTAGAG GATTTGAAGT AATTGAAGAA ATTAAATCCG CCGTAGAGAA AGAGTGTCCC  CAGACAGTCT CTTGTGCTGA TATTTTGACT CTTGCTGCTA GAGATTCAAC TGTTCTTACT GGTGGACCAA GTTGGGATGT ACCTTTGGGA AGAAGGGATT CTCTTGGTGC AAGCATAAGT  GGCTCAAACA ACAACATTCC TGCCCCAAAC AATACATTCC AAACCATCTT AACAAAATTC AAGCTTAAGG GACTTAACAT TGTTGATCTA GTTGCTCTAT CTGGTAGCCA CACTATAGGA  GATTCACGAT GCACCAGCTT TAGACAAAGA CTCTACAACC AAACTGGGAA TGGCAAGTCA GATTTCACTC TTGACCAAAA CTATGCTGCT CAATTGCGCA CTCGGTGCCC AAGATCTGGT  GGAGACCAAA ATCTATTTGT CCTAGACTTT GTCACACCAG TAAAATTCGA CAACAACTAC TACAAGAATT TATTGGCCAA CAAGGGTCTC CTAAGTTCTG ATGAAATTCT GTTGACAAAG  AATCAAGTAT CTGCAGATTT AGTGAAAAAG TATGCAGAAA GCAATGATCT TTTCTTTGAG CAATTTGCCA AGTCCATGGT TAAGATGGGA AACATTACTC CCTTAACAGG ATCAAGGGGT  GAAATCAGAA AACGCTGCAG AAAGATTAAT AACTGATGAA GTACTATCGT TGTCATGTTG CACATGTGAA ATTGCATTCT ACATTTGTTG ATCTTTTGTT TATTTAGCCA TTTTTTTTTT  ATGAAGCCAT TGGCATAGTC GCTGTGTCCT GAGTATAAAA TTTGGGCTTT TGGTAGCATT GTTGTGTGTT TGAAGAAATT CTATGTAATA AGATGTTTCA AAAATTGGTT AATAAAGTGC 
GAAGTTGTCG 

Retrieve as FASTA