Entry information : MtPrx50 (Medtr1g038680.1[4.0] / Medtr1g038680.1[3.5] / Medtr1g046440.1[3.0])
Entry ID 374
Creation 2006-12-18 (Christophe Dunand)
Last sequence changes 2006-12-18 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-07-29 (Messaoudi)
Peroxidase information: MtPrx50 (Medtr1g038680.1[4.0] / Medtr1g038680.1[3.5] / Medtr1g046440.1[3.0])
Name (synonym) MtPrx50 (Medtr1g038680.1[4.0] / Medtr1g038680.1[3.5] / Medtr1g046440.1[3.0])
Class Class III peroxidase    [Orthogroup: Prx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Arbuscular mycorrhiza (inoculated root)
Mycorrhizal roots
Roots
Inducers Glomus intraradices infection
Mycorrhiza
Nitrogen starvation
Phosphate starvation
Sinorhizobium inoculation
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx50
start..stop
S start..stop
GmPrx189 492 5e-177 7..332 6..328
GmPrx195 485 2e-174 7..332 6..328
GmPrx312 470 2e-168 1..332 1..329
GmPrx190 449 3e-160 30..332 29..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14256184..14256405 222 N° 2 14257210..14257986 777  
join(14256184..14256405,14257210..14257986)


exon

Literature and cross-references MtPrx50 (Medtr1g038680.1[4.0] / Medtr1g038680.1[3.5] / Medtr1g046440.1[3.0])
Literature Journet,E.P. et al., unpublished
DNA ref. Phytozome 11:   chr1 (14256184..14257986)
Cluster/Prediction ref. Phytozome Gene 11:   31092775 UniGene:   Mtr.7621 [3' end]
Omic ref. Gene atlas:   Mtr.41397.1.S1_at Legoo:   Mtr.41397.1.S1_at
Protein sequence: MtPrx50 (Medtr1g038680.1[4.0] / Medtr1g038680.1[3.5] / Medtr1g046440.1[3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa): %sProtein length in amino acid 332 (305)
PWM (Da): %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
35595.58 (32708.1) Transmb domain: %sTransmembrane domain
Calculation done with TMHMM
The topology is given as the position of the transmembrane helices
separated by i if the loop is on the inside or o if it is on the outside.
For example i7-29o44-66i87-109o means that it starts on the inside,
has a predicted TMH at position 7 to 29, the outside, then a TMH at position 44-66 etc.
i12-34o
PI (pH): %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
5.09 (5.08) Peptide Signal: %sProtein signal for mature protein.
if exist :cut position of signal peptide.
range: start-end pos of mature protein
cut: 28 range:28-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDSIPYMHQMVSSLVLIILSISSLASASLQVGFYSYSCPSAEAIVRSAIDKAVSLNPGIGAGLIRMHFHDCFVRGCDASVLLASTPGNPIAEKDNFINNPSLHGFEVIDEAKAQLEVVCPQTVSCADILTFATRDSILKLSGGTINYDVPSGRRDGRVSISDEVPKNIPSPFLNADQLIANFAQKGLSIDEMVTLSGAHSIGVSHCSSFSNRLYSFSDTISQDPSMDPSFAESLKTKCPPPPSNTNPIVMLDVATPNRLDNLYYEGLINHRGLLTSDQTLLSSQSTQESVLSNANYGSNWATKFAQAMVHMGSIDVLSGYDGEIRKHCSFVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1) and 6 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATAGTATACCATACATGCATCAAATGGTTTCTAGCTTGGTTTTGATAATTCTATCTATTTCTTCATTGGCTTCAGCATCTCTGCAGGTGGGTTTCTATAGCTACTCATGTCCATCT
GCTGAGGCAATAGTGAGAAGTGCAATTGACAAAGCTGTTTCACTCAATCCTGGTATAGGTGCTGGATTGATTAGAATGCATTTTCATGATTGCTTTGTGAGG
GTAAGCTCATGTTCACAT
CAATTTTCATACATATATTAGAAAAACTTAAATAAATGACTGAAAATTAAACACAAAAAATATAATAAGTCTCTAATTTAGTGTCTTTATCTTTTGGATATAATTATGAACATATTTAAT
TTTCTTTTATAGTGTCTAAAGAGGTGTTTTGATTCAAGGATCAAAATTTATTTACAATTACAAGAACACTTGTTTTGGCATGTCCTTACATTCAAATATGATATTTGTTTATGGTTTTAC
AAATTATGTTTAAGTACTTTTTATATATATGAAGATGATTTAGGGCCTTTGGCTTATTTTAGTTTTATCTACTAGCATAAGAACTTGTGGCACTATTTAGAAAAACTTATAAAAACAACT
TAGGACATGGTCATAAGTTGTTTTCAGCTTATTTCAATATGTTATCCATAGTTGTTTATGAAAATAGTTTGACTTAACTTTATTTTATGTTATAGAAATAATTTATTCGTAAGCGTCTGT
AAAATAAACTATTTATCCAAACAAATTTTTACTCGTATTATTTTCATTCGCGTGTCAAGGGTGAGAATCAAACATTTTAATAGAAATAAAAGATAATCTATACTTTTAACAGTTTTTTTT
TAAAAAAATAGATAAAAATTTCAAAAATATTCTTCAGTATTTTAATTGCTTATGAAACACAATGGTTGAGATAGAATTTCTAGCAATAAATTTTTGAATTATGATTTTTATCATTGAAAC
AAACACACCTAAATATATGAAATTGATGACTTCCAAGTATCTAAATATATTAAATTCTATGTATAGGGTTGTGATGCTTCTGTGTTACTAGCATCAACACCAGGAAATCCAATAGCTGAG
AAAGACAACTTTATCAACAATCCAAGTCTACATGGATTTGAGGTAATTGATGAGGCCAAGGCTCAATTAGAAGTCGTATGTCCGCAAACAGTATCGTGTGCGGACATTCTTACATTTGCT
ACACGAGACAGTATTCTCAAACTTAGTGGTGGCACTATAAATTACGATGTACCTTCAGGACGGAGGGATGGCCGTGTCTCAATCAGCGACGAAGTGCCAAAAAATATACCTTCACCTTTC
CTCAATGCTGACCAACTTATAGCAAATTTTGCACAAAAAGGTTTGTCAATTGATGAAATGGTTACACTCTCAGGAGCACATTCAATTGGTGTATCACATTGTTCTTCTTTCTCTAATCGT
TTATATTCATTTAGTGATACAATTTCTCAAGATCCTTCTATGGACCCTTCATTTGCTGAATCTTTGAAAACAAAGTGTCCACCACCACCAAGTAACACTAATCCAATAGTGATGCTTGAT
GTTGCTACTCCTAATCGTTTGGACAATTTGTATTATGAGGGATTGATTAACCATCGTGGATTGTTGACTTCAGATCAAACCTTGTTGAGTAGTCAATCTACACAAGAAAGTGTGCTAAGT
AATGCTAATTATGGTTCAAATTGGGCTACTAAGTTTGCACAAGCAATGGTGCATATGGGTTCTATTGATGTGTTAAGTGGCTATGATGGTGAGATTAGGAAACACTGCAGCTTTGTCAAT
TAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATAGTATACCATACATGCATCAAATGGTTTCTAGCTTGGTTTTGATAATTCTATCTATTTCTTCATTGGCTTCAGCATCTCTGCAGGTGGGTTTCTATAGCTACTCATGTCCATCT
GCTGAGGCAATAGTGAGAAGTGCAATTGACAAAGCTGTTTCACTCAATCCTGGTATAGGTGCTGGATTGATTAGAATGCATTTTCATGATTGCTTTGTGAGG
GGTTGTGATGCTTCTGTG
TTACTAGCATCAACACCAGGAAATCCAATAGCTGAGAAAGACAACTTTATCAACAATCCAAGTCTACATGGATTTGAGGTAATTGATGAGGCCAAGGCTCAATTAGAAGTCGTATGTCCG
CAAACAGTATCGTGTGCGGACATTCTTACATTTGCTACACGAGACAGTATTCTCAAACTTAGTGGTGGCACTATAAATTACGATGTACCTTCAGGACGGAGGGATGGCCGTGTCTCAATC
AGCGACGAAGTGCCAAAAAATATACCTTCACCTTTCCTCAATGCTGACCAACTTATAGCAAATTTTGCACAAAAAGGTTTGTCAATTGATGAAATGGTTACACTCTCAGGAGCACATTCA
ATTGGTGTATCACATTGTTCTTCTTTCTCTAATCGTTTATATTCATTTAGTGATACAATTTCTCAAGATCCTTCTATGGACCCTTCATTTGCTGAATCTTTGAAAACAAAGTGTCCACCA
CCACCAAGTAACACTAATCCAATAGTGATGCTTGATGTTGCTACTCCTAATCGTTTGGACAATTTGTATTATGAGGGATTGATTAACCATCGTGGATTGTTGACTTCAGATCAAACCTTG
TTGAGTAGTCAATCTACACAAGAAAGTGTGCTAAGTAATGCTAATTATGGTTCAAATTGGGCTACTAAGTTTGCACAAGCAATGGTGCATATGGGTTCTATTGATGTGTTAAGTGGCTAT
GATGGTGAGATTAGGAAACACTGCAGCTTTGTCAATTAG

Retrieve as FASTA