Entry information : MtPrx50 (Medtr1g038680.1[4.0] / Medtr1g038680.1[3.5] / Medtr1g046440.1[3.0])
Entry ID 374
Creation 2006-12-18 (Christophe Dunand)
Last sequence changes 2006-12-18 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-07-29 (Messaoudi)
Peroxidase information: MtPrx50 (Medtr1g038680.1[4.0] / Medtr1g038680.1[3.5] / Medtr1g046440.1[3.0])
Name (synonym) MtPrx50 (Medtr1g038680.1[4.0] / Medtr1g038680.1[3.5] / Medtr1g046440.1[3.0])
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Arbuscular mycorrhiza (inoculated root)
Mycorrhizal roots
Roots
Inducers Glomus intraradices infection
Mycorrhiza
Nitrogen starvation
Phosphate starvation
Sinorhizobium inoculation
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx50
start..stop
S start..stop
GmPrx189 492 5e-177 7..332 6..328
GmPrx195 485 3e-174 7..332 6..328
GmPrx312 470 2e-168 1..332 1..329
GmPrx190 449 3e-160 30..332 29..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14256184..14256405 222 N° 2 14257210..14257986 777  
join(14256184..14256405,14257210..14257986)


exon

Literature and cross-references MtPrx50 (Medtr1g038680.1[4.0] / Medtr1g038680.1[3.5] / Medtr1g046440.1[3.0])
Literature Journet,E.P. et al., unpublished
DNA ref. Phytozome 11:   chr1 (14256184..14257986)
Cluster/Prediction ref. Phytozome Gene 11:   31092775 UniGene:   Mtr.7621 [3' end]
Omic ref. Gene atlas:   Mtr.41397.1.S1_at Legoo:   Mtr.41397.1.S1_at
Protein sequence: MtPrx50 (Medtr1g038680.1[4.0] / Medtr1g038680.1[3.5] / Medtr1g046440.1[3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (305)
PWM (Da):   %s   35595.58 (32708.1) Transmb domain:   %s   i12-34o
PI (pH):   %s   5.09 (5.08) Peptide Signal:   %s   cut: 28 range:28-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDSIPYMHQMVSSLVLIILSISSLASASLQVGFYSYSCPSAEAIVRSAIDKAVSLNPGIGAGLIRMHFHDCFVRGCDASVLLASTPGNPIAEKDNFINNPSLHGFEVIDEAKAQLEVVCPQTVSCADILTFATRDSILKLSGGTINYDVPSGRRDGRVSISDEVPKNIPSPFLNADQLIANFAQKGLSIDEMVTLSGAHSIGVSHCSSFSNRLYSFSDTISQDPSMDPSFAESLKTKCPPPPSNTNPIVMLDVATPNRLDNLYYEGLINHRGLLTSDQTLLSSQSTQESVLSNANYGSNWATKFAQAMVHMGSIDVLSGYDGEIRKHCSFVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1) and 6 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATAGTATACCATACATGCATCAAATGGTTTCTAGCTTGGTTTTGATAATTCTATCTATTTCTTCATTGGCTTCAGCATCTCTGCAGGTGGGTTTCTATAGCTACTCATGTCCATCT
GCTGAGGCAATAGTGAGAAGTGCAATTGACAAAGCTGTTTCACTCAATCCTGGTATAGGTGCTGGATTGATTAGAATGCATTTTCATGATTGCTTTGTGAGG
GTAAGCTCATGTTCACAT
CAATTTTCATACATATATTAGAAAAACTTAAATAAATGACTGAAAATTAAACACAAAAAATATAATAAGTCTCTAATTTAGTGTCTTTATCTTTTGGATATAATTATGAACATATTTAAT
TTTCTTTTATAGTGTCTAAAGAGGTGTTTTGATTCAAGGATCAAAATTTATTTACAATTACAAGAACACTTGTTTTGGCATGTCCTTACATTCAAATATGATATTTGTTTATGGTTTTAC
AAATTATGTTTAAGTACTTTTTATATATATGAAGATGATTTAGGGCCTTTGGCTTATTTTAGTTTTATCTACTAGCATAAGAACTTGTGGCACTATTTAGAAAAACTTATAAAAACAACT
TAGGACATGGTCATAAGTTGTTTTCAGCTTATTTCAATATGTTATCCATAGTTGTTTATGAAAATAGTTTGACTTAACTTTATTTTATGTTATAGAAATAATTTATTCGTAAGCGTCTGT
AAAATAAACTATTTATCCAAACAAATTTTTACTCGTATTATTTTCATTCGCGTGTCAAGGGTGAGAATCAAACATTTTAATAGAAATAAAAGATAATCTATACTTTTAACAGTTTTTTTT
TAAAAAAATAGATAAAAATTTCAAAAATATTCTTCAGTATTTTAATTGCTTATGAAACACAATGGTTGAGATAGAATTTCTAGCAATAAATTTTTGAATTATGATTTTTATCATTGAAAC
AAACACACCTAAATATATGAAATTGATGACTTCCAAGTATCTAAATATATTAAATTCTATGTATAGGGTTGTGATGCTTCTGTGTTACTAGCATCAACACCAGGAAATCCAATAGCTGAG
AAAGACAACTTTATCAACAATCCAAGTCTACATGGATTTGAGGTAATTGATGAGGCCAAGGCTCAATTAGAAGTCGTATGTCCGCAAACAGTATCGTGTGCGGACATTCTTACATTTGCT
ACACGAGACAGTATTCTCAAACTTAGTGGTGGCACTATAAATTACGATGTACCTTCAGGACGGAGGGATGGCCGTGTCTCAATCAGCGACGAAGTGCCAAAAAATATACCTTCACCTTTC
CTCAATGCTGACCAACTTATAGCAAATTTTGCACAAAAAGGTTTGTCAATTGATGAAATGGTTACACTCTCAGGAGCACATTCAATTGGTGTATCACATTGTTCTTCTTTCTCTAATCGT
TTATATTCATTTAGTGATACAATTTCTCAAGATCCTTCTATGGACCCTTCATTTGCTGAATCTTTGAAAACAAAGTGTCCACCACCACCAAGTAACACTAATCCAATAGTGATGCTTGAT
GTTGCTACTCCTAATCGTTTGGACAATTTGTATTATGAGGGATTGATTAACCATCGTGGATTGTTGACTTCAGATCAAACCTTGTTGAGTAGTCAATCTACACAAGAAAGTGTGCTAAGT
AATGCTAATTATGGTTCAAATTGGGCTACTAAGTTTGCACAAGCAATGGTGCATATGGGTTCTATTGATGTGTTAAGTGGCTATGATGGTGAGATTAGGAAACACTGCAGCTTTGTCAAT
TAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATAGTATACCATACATGCATCAAATGGTTTCTAGCTTGGTTTTGATAATTCTATCTATTTCTTCATTGGCTTCAGCATCTCTGCAGGTGGGTTTCTATAGCTACTCATGTCCATCT
GCTGAGGCAATAGTGAGAAGTGCAATTGACAAAGCTGTTTCACTCAATCCTGGTATAGGTGCTGGATTGATTAGAATGCATTTTCATGATTGCTTTGTGAGG
GGTTGTGATGCTTCTGTG
TTACTAGCATCAACACCAGGAAATCCAATAGCTGAGAAAGACAACTTTATCAACAATCCAAGTCTACATGGATTTGAGGTAATTGATGAGGCCAAGGCTCAATTAGAAGTCGTATGTCCG
CAAACAGTATCGTGTGCGGACATTCTTACATTTGCTACACGAGACAGTATTCTCAAACTTAGTGGTGGCACTATAAATTACGATGTACCTTCAGGACGGAGGGATGGCCGTGTCTCAATC
AGCGACGAAGTGCCAAAAAATATACCTTCACCTTTCCTCAATGCTGACCAACTTATAGCAAATTTTGCACAAAAAGGTTTGTCAATTGATGAAATGGTTACACTCTCAGGAGCACATTCA
ATTGGTGTATCACATTGTTCTTCTTTCTCTAATCGTTTATATTCATTTAGTGATACAATTTCTCAAGATCCTTCTATGGACCCTTCATTTGCTGAATCTTTGAAAACAAAGTGTCCACCA
CCACCAAGTAACACTAATCCAATAGTGATGCTTGATGTTGCTACTCCTAATCGTTTGGACAATTTGTATTATGAGGGATTGATTAACCATCGTGGATTGTTGACTTCAGATCAAACCTTG
TTGAGTAGTCAATCTACACAAGAAAGTGTGCTAAGTAATGCTAATTATGGTTCAAATTGGGCTACTAAGTTTGCACAAGCAATGGTGCATATGGGTTCTATTGATGTGTTAAGTGGCTAT
GATGGTGAGATTAGGAAACACTGCAGCTTTGTCAATTAG

Retrieve as FASTA