Entry information : WbGPx01 ( gp29)
Entry ID 3751
Creation 2006-08-25 (Marcia Pinheiro Margis)
Last sequence changes 2016-02-16 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-16 (Achraf Jemmat)
Peroxidase information: WbGPx01 ( gp29)
Name (synonym) WbGPx01 ( gp29)
Class Animal glutathione peroxidase    [Orthogroup: Gpx1001]
Taxonomy Eukaryota Metazoa Chromadorea Onchocercidae Wuchereria
Organism Wuchereria bancrofti    [TaxId: 6293 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value WbGPx01
start..stop
S start..stop
BpaGPx01 452 6e-165 1..223 1..223
BmalGPx01 452 6e-165 1..223 1..223
DiGPx01 347 3e-123 1..223 1..221
CelGPx03 259 8e-89 7..222 6..221
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..64 64 N° 2 325..483 159 N° 3 777..1021 245 N° 4 1316..1519 204
join(1..64,325..483,777..1021,1316..1519)


exon

Literature and cross-references WbGPx01 ( gp29)
Literature Cookson E., Tang L., Selkirk M.E. Conservation of primary sequence of gp29, the major soluble cuticular glycoprotein, in three species of lymphatic filariae. Mol. Biochem. Parasitol. 58:155-160(1993).
Protein ref. UniProtKB:   P35666
DNA ref. GenBank:   X69126.1
Protein sequence: WbGPx01 ( gp29)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   223 (204)
PWM (Da):   %s   25715.3 (23673.1)  
PI (pH):   %s   9.05 (9.05) Peptide Signal:   %s   cut: 20 range:20-223
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSAQLLILSHVVLLQLIVAQLGPKIGKQFLKPKQCEITNQTVYDFHAQMLNGAQRSLTEYRNKVLLIVNVATYCAYTMQYRDFNPILGSNSNGTLNILGFPCNQFYLQEPAENHELLNGLKYVRPGHGWEPHKNMHIFGKLEVNGENDHPLYKFLERCPPTVPVIGKRHQLIYDPIGTNDVIWNFEKFLVDKKGRPRYRFHPENWVQGTAVKPYIDELEREI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCGCACAACTTTTGATTTTATCGCACGTGGTGTTATTGCAACTTATTGTTGCACAACTGGGTAAGAAATTTTAGTAAATGAAATACACAAAACTTGAAAAAATTATTTTATACAAA
ATAGATTATGCTCAGGTACGGAGAGGTATAGTAACTTAGTCAATTATGGAAAGTGTTTAAATTAAATAAAAATCTATTTGTGTTAAAAAATCTTTCCCAAAAAGCTGGTGATTTTATTTT
TGATTAGGAAAATATTTCAGAATTATTTGATATTTATCAGGGAGATATTGAGAAGAAAAAACGATTTCAATTTCATTTTTACAGGTCCAAAAATTGGCAAACAATTCTTAAAACCGAAGC
AGTGTGAAATAACTAATCAAACAGTGTATGATTTTCACGCTCAAATGCTAAACGGTGCACAAAGAAGTTTGACAGAATATCGCAACAAAGTTCTTTTAATCGTTAATGTCGCTACTTACT
GCG
GTAAACGCTTCTCTTCTTTATGCTTCAAATAAGGCGTCGTTTTTATTTGTAGTAATGTTCAATTTCTTTTTAATTTTCAGAAAGTATTTTTTGTTGCTGTTCTTATCGAAAGTTAAG
AGGTTGATATGTCGTTGAAGTTGTGACAGAATGATTATTTTCTCGAAGGGAGACGAGGAAGAAAGCTGACTTCTTCCTCTCCATAGGGAAGTTTAAAATATTTTAACCCTAGAAGACGTA
TATATGGTTCCTTTCAACTTATTGATTTCTGCATTCAATGAACGAGAAATTTTCAGCATACACAATGCAATACAGAGATTTCAATCCAATACTTGGAAGTAATTCTAATGGAACGCTCAA
TATCCTAGGATTTCCATGCAATCAATTTTACTTGCAAGAACCAGCAGAAAATCATGAGTTGTTGAATGGTTTGAAATATGTAAGACCAGGACATGGCTGGGAACCACACAAAAACATGCA
TATTTTTGGCAAACTTGAAGTTAATGGTGAAAATGATCATCCACTTTACAAATTTTTGAAG
GTCTTGTTGTATAATTTTTCTGGAAAAACTTCTTTATTTATTATTTTCCATTCATTTTA
TCGTCAAAAAAGCAGTGCGTTAGTTTTACTTTTCATACGTTTTTCGCATTTTTGTTGGATTTCCTTTTTAAGATTTTAGAAATTAACTCCACTTATACTTTAATCCGTTTTATTGCTTAG
AAAAGTTTTTTTCCATATATATCAAAACAAACGTATATAAGAAGAATCGTCTGCTAAAAACTGGTAACGTGTCTCATGAGCCTACTGATTATCATTGAAAAGAACTCTTTTATAGGAACG
TTGCCCGCCGACAGTGCCAGTAATTGGAAAGCGTCATCAGTTAATATACGATCCCATAGGTACAAATGATGTTATTTGGAATTTTGAAAAATTCTTGGTTGATAAGAAAGGTCGTCCACG
TTACCGTTTTCATCCCGAAAATTGGGTTCAAGGAACTGCTGTAAAGCCATATATCGATGAACTGGAACGTGAAATTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCGCACAACTTTTGATTTTATCGCACGTGGTGTTATTGCAACTTATTGTTGCACAACTGGGTCCAAAAATTGGCAAACAATTCTTAAAACCGAAGCAGTGTGAAATAACTAATCAA
ACAGTGTATGATTTTCACGCTCAAATGCTAAACGGTGCACAAAGAAGTTTGACAGAATATCGCAACAAAGTTCTTTTAATCGTTAATGTCGCTACTTACTGCG
CATACACAATGCAATAC
AGAGATTTCAATCCAATACTTGGAAGTAATTCTAATGGAACGCTCAATATCCTAGGATTTCCATGCAATCAATTTTACTTGCAAGAACCAGCAGAAAATCATGAGTTGTTGAATGGTTTG
AAATATGTAAGACCAGGACATGGCTGGGAACCACACAAAAACATGCATATTTTTGGCAAACTTGAAGTTAATGGTGAAAATGATCATCCACTTTACAAATTTTTGAAG
GAACGTTGCCCG
CCGACAGTGCCAGTAATTGGAAAGCGTCATCAGTTAATATACGATCCCATAGGTACAAATGATGTTATTTGGAATTTTGAAAAATTCTTGGTTGATAAGAAAGGTCGTCCACGTTACCGT
TTTCATCCCGAAAATTGGGTTCAAGGAACTGCTGTAAAGCCATATATCGATGAACTGGAACGTGAAATTTAA

Retrieve as FASTA