Entry information : AniCcP01
Entry ID 3835
Creation 2006-08-30 (Christophe Dunand)
Last sequence changes 2006-08-30 (Christophe Dunand)
Sequence status complete
Reviewer Filippo Passardi
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: AniCcP01
Name AniCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Emericella
Organism Aspergillus nidulans-Emericella nidulans    [TaxId: 162425 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AniCcP01
start..stop
S start..stop
AteCcP01_NIH2624 546 0 1..302 1..302
AnCcP01 536 0 1..307 1..307
AclCcP01 536 0 1..302 1..302
AfumCcP01 535 0 1..302 1..302
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2809629..2809738 110 N° 2 2808737..2809565 829  
complement(join(2808737..2809565,2809629..2809738))


exon

Literature and cross-references AniCcP01
Literature Galagan,J.E. et al., Sequencing of Aspergillus nidulans and comparative analysis with A.fumigatus and A. oryzae. Nature 438 (7071), 1105-1115 (2005)
Protein ref. UniProtKB:   Q5B1Z0
DNA ref. JGI genome:   ChrV_A_nidulans_FGSC_A4 (2809738..2808737)
Protein sequence: AniCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   312
PWM (Da):   %s   34386.06  
PI (pH):   %s   6.52
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSKPGDYNAVRRDIAAQLKKPGYDDGSAGPVFVRLAWHSSGTYDAASDTGGSNGAGMRYEAEGGDPANAGLQHGRAFLEPVKEKHPWITYSDLWTLAGVVAIEEMGGPKIPWLPGRTDFVDDSKVPPRGRLPDGAQGADHLRFIFYRMGFNDQEIVALAGGHNLGRCHADRSGFQGPWVNNPTRFSNQFFKLLLNMEWKPKTLENGVSQFVYIDPEAEDHEEPLMMLPTDVALRDDPAFRPWVERYAKDKDLFFDHFSKAFAKLIELGIQRDASGKVTNTDNVKGGYHSAPKKSDEPTGPPRPHTAQRAAKL

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (chromo V, 1 intron). Strain="FGSC A4".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCAAACCCGGAGACTACAACGCAGTCCGACGCGACATCGCCGCGCAGCTCAAGAAGCCCGGCTACGATGATGGTAGCGCAGGCCCCGTCTTCGTCCGTCTCGCATGGTTCGTCCCT
GATACAGAACTTCTCTTGTATCCCGACGGTGACCGCTAACAAGCTTTTAATAGGCACTCCTCCGGCACATACGACGCTGCAAGCGATACCGGCGGCTCTAACGGCGCGGGAATGCGCTAT
GAAGCCGAAGGTGGCGACCCGGCAAACGCCGGTCTCCAACACGGCCGCGCCTTCCTAGAGCCCGTGAAGGAGAAGCACCCCTGGATCACATACAGCGATTTGTGGACGCTTGCAGGCGTC
GTCGCAATCGAAGAGATGGGCGGGCCCAAGATTCCGTGGCTACCGGGCCGTACCGACTTTGTCGACGACTCCAAGGTGCCTCCGCGCGGACGATTGCCTGATGGCGCACAGGGCGCCGAC
CACCTCCGCTTCATCTTCTACCGGATGGGCTTCAACGACCAAGAGATCGTGGCACTGGCGGGCGGACACAACCTAGGACGGTGCCATGCTGATCGCTCAGGGTTCCAGGGCCCTTGGGTG
AACAATCCGACGCGGTTCTCGAACCAGTTCTTCAAACTGCTGCTGAATATGGAGTGGAAGCCCAAGACGTTAGAGAACGGTGTTAGTCAGTTTGTGTATATTGATCCGGAGGCGGAGGAC
CATGAGGAGCCGCTCATGATGCTACCAACAGACGTTGCGTTGAGGGATGATCCTGCGTTCCGGCCTTGGGTGGAACGGTATGCGAAGGACAAGGATCTCTTCTTTGACCACTTCTCGAAG
GCATTTGCCAAGTTGATTGAGTTGGGGATCCAGAGAGATGCGAGCGGCAAGGTCACGAATACCGATAACGTCAAGGGTGGCTACCACTCTGCGCCCAAGAAGAGCGATGAGCCGACTGGG
CCGCCCCGTCCGCATACAGCTCAGCGTGCTGCTAAGCTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCAAACCCGGAGACTACAACGCAGTCCGACGCGACATCGCCGCGCAGCTCAAGAAGCCCGGCTACGATGATGGTAGCGCAGGCCCCGTCTTCGTCCGTCTCGCATGGCACTCCTCC
GGCACATACGACGCTGCAAGCGATACCGGCGGCTCTAACGGCGCGGGAATGCGCTATGAAGCCGAAGGTGGCGACCCGGCAAACGCCGGTCTCCAACACGGCCGCGCCTTCCTAGAGCCC
GTGAAGGAGAAGCACCCCTGGATCACATACAGCGATTTGTGGACGCTTGCAGGCGTCGTCGCAATCGAAGAGATGGGCGGGCCCAAGATTCCGTGGCTACCGGGCCGTACCGACTTTGTC
GACGACTCCAAGGTGCCTCCGCGCGGACGATTGCCTGATGGCGCACAGGGCGCCGACCACCTCCGCTTCATCTTCTACCGGATGGGCTTCAACGACCAAGAGATCGTGGCACTGGCGGGC
GGACACAACCTAGGACGGTGCCATGCTGATCGCTCAGGGTTCCAGGGCCCTTGGGTGAACAATCCGACGCGGTTCTCGAACCAGTTCTTCAAACTGCTGCTGAATATGGAGTGGAAGCCC
AAGACGTTAGAGAACGGTGTTAGTCAGTTTGTGTATATTGATCCGGAGGCGGAGGACCATGAGGAGCCGCTCATGATGCTACCAACAGACGTTGCGTTGAGGGATGATCCTGCGTTCCGG
CCTTGGGTGGAACGGTATGCGAAGGACAAGGATCTCTTCTTTGACCACTTCTCGAAGGCATTTGCCAAGTTGATTGAGTTGGGGATCCAGAGAGATGCGAGCGGCAAGGTCACGAATACC
GATAACGTCAAGGGTGGCTACCACTCTGCGCCCAAGAAGAGCGATGAGCCGACTGGGCCGCCCCGTCCGCATACAGCTCAGCGTGCTGCTAAGCTGTAG

Retrieve as FASTA