Entry information : KflPrx03 (kfl00122_0210)
Entry ID 384
Creation 2008-10-08 (Christophe Dunand)
Last sequence changes 2017-09-18 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-09-18 (Christophe Dunand)
Peroxidase information: KflPrx03 (kfl00122_0210)
Name (synonym) KflPrx03 (kfl00122_0210)
Class Class III peroxidase    [Orthogroup: Prx140]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflPrx03
start..stop
S start..stop
SmPrx03-1_122 277 9e-93 26..326 14..316
RobtPrx02 276 2e-92 33..326 4..296
SmPrx03-2_114 275 8e-92 26..326 14..316
SmPrx35-2_170 273 6e-91 33..326 28..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 184682..184915 234 N° 2 183935..184123 189 N° 3 183277..183442 166 N° 4 182571..182674 104
N° 5 181763..181936 174 N° 6 181120..181239 120  
complement(join(181120..181239,181763..181936,182571..182674,183277..183442,1839 35..184123,184682..184915))


exon

Literature and cross-references KflPrx03 (kfl00122_0210)
Protein ref. GenBank:   GAQ82752.1
DNA ref. GenBank:   DF237071.1 (184915..181120)
Protein sequence: KflPrx03 (kfl00122_0210)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (302)
PWM (Da):   %s   35338.98 (32279.3)  
PI (pH):   %s   6.5 (6.15) Peptide Signal:   %s   cut: 27 range:27-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPPTFSWHILLTLLAVSWLNQTVIAISIVSPLNVTYYATSCPQVHEVVRERLAVAFKEDRTVAGSVARLLFHDCFVEGCDASVLLNSTASISGEKDAFQSMTLAGFDVIDDIKAHIETVCPSTVSCADIVALASTESIFQSGGPNISMPLGRVDGRVSSKAAALAAMPNVTMNVTVLNASFAAVGLTLGDMVILSGAHTFGKAHCSNVVDRLLPVDPTLDPALAQNLTQCNPRVNDPTITVPLDVATNATFDNQYYKNLLQGRGVLASDEVLAHDNRTVKLVQRMATNERAFFKNFSHAWVRMSMIGVKTGQEGEIRRNCGVVNRR*

Retrieve as FASTA  
Remarks Complete sequence from Genomic (3 introns and 2 extra ones in 3'end).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCACCGACCTTCTCTTGGCACATCCTGCTGACGTTACTAGCAGTCAGCTGGCTCAATCAAACGGTCATCGCAATAAGCATAGTGTCGCCCCTCAATGTGACGTACTATGCAACG
TCATGCCCGCAAGTGCATGAAGTGGTTAGGGAAAGGTTAGCGGTTGCGTTCAAAGAGGATAGAACAGTGGCGGGCTCCGTGGCTCGGCTGCTCTTCCACGATTGCTTTGTTGAG
GTGAGC
TCCCACAGACTGTTGCTTTCCTGCGCTAGTTCAATTTTCACCCTTTGTCTCTTTGCTCTTCATTAGCTCTCAAATCTCACAACCTACACACAGGCCTCAGTTCGAACTGGCGCTTTTCGT
CCTTAATGGTTCACAGGAGCTGCAGGTCAGAATACAGGCATGCATCGGAACTGGCAGTCCAAACTGAGAAGGTGGCTAGAGTACACGGAGACGAGACCCTGCATGAGGCAACGCCTGCAT
GCCTGTCCTCCAGAGAGAGTAGACTGGCGGAGATGGTGGTAAAATCATCGTGAAATAACCCAAGAAAATGCCAAGCATTACAAAACCAACAGAAAATAAGCAGATTCAAAATCCATAGCT
GAAAAAGGCACTGAAACAAAGCAAAGTTCCTGCTACTGCTGCCCATGTCCACTTGCAACATAAATAGTGTAAGTTTTCTTTACCACCTCCTCAGTGACTCCCGTTATTTTGCCCCCCCGT
TTGGTTGAAGGTCAAATAGTCCTGTCCTCTGCCTATCAAGAAAAAAAAACCATAGTACGTCTTGTTCTGTAGGGTTGCGACGCCTCTGTTCTCCTGAATTCGACGGCCTCAATCTCGGGC
GAGAAGGACGCATTTCAAAGCATGACGCTGGCGGGATTTGACGTTATTGATGACATCAAGGCCCACATAGAGACGGTTTGCCCTAGCACCGTGTCGTGCGCGGATATCGTTGCTCTCGCC
AGTACCGAGTCAATCTTCCAG
GTGCGTACGTTAACTGGCTTCCAATCTCCATTGCTTGCCAAGATTGAATCTTCACCACTGAACCAATCACAAAGTACAGGCTTAACTACTTCAAGACGA
TCAGTGAATGATCGATATCTCTGCTTTCACGTGTCCTCCTATTTGAGTCAACAGCAGGAGTACAGAACGCTCACATCTTGTACTTTCACAATGCCGACTCTGATTTCAAAAGGTCACCGG
ATTGGCCCGCCGACTTTTGTCGGTCAAGAATCATCGCTGCGCAATGCAGTCCGGAGGTCCAAACATGTCGAGCCCTTTATGGGCGCGTCTCCTCTCAAGACAGTCGCTCTTACTTTTCTA
CAATGCAGCCGTTCAATATTCTGTGCAGTCTACCACACCATCTTCTTATATGCACACGACGGCGACGCTTCTCTCGAGTCATACTGAAGCGGCCCCAACTGTCTCACATAGTGGGAGGTT
CCAATTTAGAGAACTTGTTTTCGCTTTATGCAGTCTGGGGGGCCCAACATCTCGATGCCGCTGGGGCGCGTCGACGGCCGCGTTTCCTCCAAGGCGGCCGCGCTCGCGGCCATGCCGAAC
GTAACGATGAATGTGACGGTTCTCAACGCGTCGTTTGCCGCCGTCGGGCTGACTCTGGGGGACATGGTAATTCTTTCTG
GTGAGCAACACGCTGCTTGAGACCTTGTGCGAAGTATCAAG
CGGTTTGGTGCGTTTGGATGTGGGCAATCAAGACAGCCGGGGTCGGAGATGAATCTTCGTGGGGTTTTACGGACCTTGTTCTGCAGAATGGAACGGCGCAGTAAGGAGAATTTGAAGAGC
TCGACCGCCCGCTCCATGTGCCGGTTGGTAAGTAAGACTGCTTGCAGTCGAATGGCTTCAACCCCGCAGTCTCCGGTTGTCATAGTAAGACAAGGCCTCAGTACTTGCCCTGCTTTGCGT
GGTTCAGACCTGCCTTAGTGGAGGCGTAGTGGTAGATTCTGGATGAACTGAGTGTTGGCTGCGTGAGCACCCGTTATACTTCAAACTTATGAGTAGTATTTTGATATCTTTTTTTCAAAG
TAAGACGCGCGCTTCGACTAGAGCCCGAGGGTGCAGAACCCACACACCGCGCTTCTCTAGCAAACGCTTCGAGCTTTTGTGTTCGACCGGCGAATCTGTTGCTCCAAGTCTCTACGCATC
CGGAACCAGAAGTCAGATACTTGATAGAAAACAAACGCGCTTCTTTCCCTTCAAGTCTTCTCTTCGCTTCTCCGTGCGCAGGGGCCCATACCTTCGGCAAAGCGCACTGCAGCAACGTGG
TTGACCGTCTTCTACCGGTCGATCCGACGCTCGACCCAGCCCTAGCGCAAAATCTTACACAGCAG
GTGAGAAGCATTATCACGGCGGGCGTCGTAAGAATCAGAACGCCTGACGTCACCC
TGACGACGTTCGTGTTTTCAGAATTCTAGCATCTTGTCGCGCATCAGAACCCACTTCAGCACGGTACGTAGATCTTTCGCCGAAACGGATCTACTGGCTTTCCTGCTCCCAACACCTGGA
AAACGGCGTGTGGCTGTTAACCACAATGTCGTTGGTTCCCCATGACCTCTTCAACGTGGTTTGCTACCACAAAAGCTTATGAGCGCTCCACGTTCAATATCCACTCTCACTGGATAACAC
TTCCCAAGGATGGGATCCGACTTGCACCCGTTCTACAGGCATCCGCATTGTACGTTTTATGTGCACGGCCCACTGCAATAAGAACCTGCTTCGAAGAAACTTCTGCCTCGTTCCGTAGCA
CCGGGTTAAAACCTAACCCTGATTGCCATGTTCAAAGTTGATTGCACTGCAACCCCCGCATCAACGACCGAGAGTCACGGTGCCCCGCACATAGCCAGCAACCCGACTTTTGACAACCAG
TACTACAAAAAAGGTCATGAAAATCAATATTACGCTCTTTTGAGTAGTCCTAGAATCAAAAATCTGCTTTTAACTATGTCCCAAACACATGGTTTGCAGTGCAATCCCCGGGTGAACGAC
CCGACGATAACAGTGCCCCTCGACGTGGCCACGAATGCGACCTTCGACAACCAGTACTACAAGAATCTGCTCCAGGGGCGCGGCGTGCTGGCGTCCGATGAGGTGCTCGCGCATGACAAT
CGGACGGTGAAGCTCGTCCAACGGATGGCGACG
GTGAGCGCTCGCGCGCGTCTTCCTCAAGAATATATATTCTTATGGCGAGACGTTTGGAAATTGCGTGCCGGAAAACGGAAGAGCGGA
AATCTGCTGTTGACGGACGGGGTCGAAGTGGGCTCCGCTGCATTCGCGAGTCCTGGTTTTAAGCTCTTTTTTATGCTGAGCAAACAGATTCCAGTCGATCCTCTCTACGACCGTTGGAAT
GAACGAACACATGTCCTGCCTCCCCTTCCATTGACAATGCACCCATGCGACCCCGCTTGCAAACTTTGAGACAGAGAGAAAGACATCCTGAGAGACGCTCCGATGGCCGCTCCTACCGAA
ATACAAAGCGTCGAGGATAGCGTTGAGAAATTTTATTACCTTCTACGAAGACTAACGTGCAAGTCGAATTGAGAACTTTTGCTATCCGCAACCGCCCACATGTCAAATTCAACCACTACC
TACAAATTTCCCTGTCAAGTATTCCAACGCTAATCACATCCCCCGGAATCTGACACCCCTCTGACGTGCCGTGCAGAACGAGAGGGCCTTCTTCAAAAACTTTAGCCACGCGTGGGTGCG
CATGTCCATGATCGGCGTCAAAACGGGACAGGAAGGCGAGATCCGCCGAAATTGCGGAGTCGTCAACCGCCGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCACCGACCTTCTCTTGGCACATCCTGCTGACGTTACTAGCAGTCAGCTGGCTCAATCAAACGGTCATCGCAATAAGCATAGTGTCGCCCCTCAATGTGACGTACTATGCAACG
TCATGCCCGCAAGTGCATGAAGTGGTTAGGGAAAGGTTAGCGGTTGCGTTCAAAGAGGATAGAACAGTGGCGGGCTCCGTGGCTCGGCTGCTCTTCCACGATTGCTTTGTTGAG
GGTTGC
GACGCCTCTGTTCTCCTGAATTCGACGGCCTCAATCTCGGGCGAGAAGGACGCATTTCAAAGCATGACGCTGGCGGGATTTGACGTTATTGATGACATCAAGGCCCACATAGAGACGGTT
TGCCCTAGCACCGTGTCGTGCGCGGATATCGTTGCTCTCGCCAGTACCGAGTCAATCTTCCAG
TCTGGGGGGCCCAACATCTCGATGCCGCTGGGGCGCGTCGACGGCCGCGTTTCCTCC
AAGGCGGCCGCGCTCGCGGCCATGCCGAACGTAACGATGAATGTGACGGTTCTCAACGCGTCGTTTGCCGCCGTCGGGCTGACTCTGGGGGACATGGTAATTCTTTCTG
GGGCCCATACC
TTCGGCAAAGCGCACTGCAGCAACGTGGTTGACCGTCTTCTACCGGTCGATCCGACGCTCGACCCAGCCCTAGCGCAAAATCTTACACAGCAG
TGCAATCCCCGGGTGAACGACCCGACG
ATAACAGTGCCCCTCGACGTGGCCACGAATGCGACCTTCGACAACCAGTACTACAAGAATCTGCTCCAGGGGCGCGGCGTGCTGGCGTCCGATGAGGTGCTCGCGCATGACAATCGGACG
GTGAAGCTCGTCCAACGGATGGCGACG
AACGAGAGGGCCTTCTTCAAAAACTTTAGCCACGCGTGGGTGCGCATGTCCATGATCGGCGTCAAAACGGGACAGGAAGGCGAGATCCGCCGA
AATTGCGGAGTCGTCAACCGCCGCTGA

Retrieve as FASTA