Entry information : CdCIIBA01 (PERO)
Entry ID 3842
Creation 2006-09-17 (Filippo Passardi)
Last sequence changes 2013-01-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-01-28 (Christophe Dunand)
Peroxidase information: CdCIIBA01 (PERO)
Name (synonym) CdCIIBA01 (PERO)
Class Other class II peroxidase type A    [Orthogroup: CIIBA001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Psathyrellaceae Coprinellus
Organism Coprinellus disseminatus    [TaxId: 71703 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CdCIIBA01
start..stop
S start..stop
ArCIIBA 384 2e-133 3..355 6..360
CcinCIIBA 378 4e-131 28..355 30..359
PoCIIBA01_PC15 351 1e-120 1..358 1..358
PoCIIBA01_C9 351 1e-120 1..358 1..358
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 24930..25046 117 N° 2 24834..24877 44 N° 3 24750..24769 20 N° 4 24668..24684 17
N° 5 24550..24617 68 N° 6 24439..24494 56 N° 7 24358..24383 26 N° 8 24011..24298 288
N° 9 23782..23951 170 N° 10 23532..23733 202 N° 11 23402..23476 75  
complement(join(23402..23476,23532..23733,23782..23951,24011..24298,24358..24383 ,24439..24494,24550..24617,24668..24684,24750..24769,24834..24877,24930..25046))


exon

Literature and cross-references CdCIIBA01 (PERO)
Literature James,T.Y., Srivilai,P., Kues,U. and Vilgalys,R. Evolution of the Bipolar Mating System of the Mushroom Coprinellus
disseminatus From Its Tetrapolar Ancestors Involves Loss of
Mating-Type-Specific Pheromone Receptor Function. Genetics 172 (3), 1877-1891 (2006)
Protein ref. UniProtKB:   Q1WMU8
DNA ref. GenBank:   DQ056142 (25046..23402)
Protein sequence: CdCIIBA01 (PERO)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   360 (343)
PWM (Da):   %s   37644.98 (35974.0)  
PI (pH):   %s   5.89 (5.60) Peptide Signal:   %s   cut: 18 range:18-360
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRFAALVSLVAASVAIASPATHLKKRATCPGGQTVDDAQCCVWFDVLDDLQTNLFNGAKENGVHALRLQFHDSIGFSPALTASGQFGGGGSDGSIIEHDNIELTPPNGNLGGPHLHRKPRSQLNRLRRIQFAAAAGVANCPGAPRLEFLAGRPFTSQPSPPGLVPGPGNTVTRILDRMADAGFSADETVDLLASHSIAAQQGLNAAIAGSPFDSTPDRFDTQFFIETLLKGVLNPGPTTGFAEVLSPLPGEFRMQSDFAIARDPRTSCRWQELANNPQLMRTAFRTAMAKLSALGNDRSSLVDCSSVIPNPAADDTDPTLPGGKVADDIEGCAATPFPVLPIAPGPTPTIPAVVI*

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (10 introns). No EST available. Strain="C345.1".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGATTCGCTGCTCTAGTTTCCCTTGTCGCCGCTTCTGTTGCCATCGCAAGCCCTGCAACTCATCTCAAGAAGCGGGCCACATGCCCAGGAGGGCAGACTGTCGACGATGCACAGGTA
CATCTATGAGAGCGCATCGTCAGTGGTTTCTGATGCTATCCTTTCTCAGTGTTGCGTCTGGTTCGATGTTTTGGATGACCTCCAAACCAACCTGTGCGTTTTCCTGTCCGGAAGTCCCTG
TATCACTGGCAGAAGCTAACCGCATCGATCTGTCTAGGTTCAATGGCGCGAAGTGCGGTGAGTGTGTCCTGTGCCTCGATCAATCGCCTTCTTCTCAACTCATTTGACGCCATTTCCCCC
AGAGAACGGCGTTCACAAGGTAGCTTCATGCTGTACTCTGAGCAGCCCCCACATGCTGACTCGTCGCAGGCGCTTCGTCTTCAGTTCCACGACTCCATCGGGTTTTCTCCTGCTTTGACA
GCAAGCGGCCAGTTCGG
GTACGATTTCTTGCTGTTCGTAGACGCAGCCCACACTAATGTGTTTGTCCTTCAGTGGCGGAGGATCCGACGGTTCTATCATCGAGCATGATAACATCGAATT
GACTTTCC
GTCAGTGTTTCAGGAAATACTAAGTCACGGAACTGGATGTTGATAGCTCTCATAGCACCCAACGGAAACCTTGGAGGCATAGTCTGCATCGGAGCGCTCGATTGCACTGGCT
CATAACGTCTCATTCGCCGATATGTGAGCCACACCTTCATCGTAAACCTAGGAGCCAACTAAACCGGCTGCGAAGGATCCAATTCGCCGCCGCCGCGGGGGTTGCTAACTGCCCAGGAGC
TCCAAGGCTTGAGTTCCTCGCAGGAAGGCCCTTCACCTCTCAGCCCTCCCCTCCTGGCCTTGTTCCTGGACCCGGAAACACTGTGACCCGTATCTTGGACCGCATGGCCGATGCAGGTTT
TAGCGCCGACGAGACCGTAGATTTGTTGGCTTCGCACTCTATTGCCGCACAACAAGGGCTGAACGCTGCAATTGCA
GTACGTGCGATGATTTTCTAATGCCACAGGTCCGTTTCGCTGAC
CTGGTTATCGTGTAGGGCTCCCCATTCGACTCAACCCCCGATAGGTTCGACACCCAGTTCTTCATTGAGACCCTGCTTAAAGGTGTCTTGAACCCTGGACCGACTACCGGATTTGCTGAG
GTCCTCTCTCCTCTTCCTGGAGAGTTCCGCATGCAGTCTGACTTCGCCATCGCTCGTGACCCTCG
GTATGATCTTTCCTCACTTTTGGGAGTTTAACTCACCGAGTCTCCCAGCACTTCC
TGCCGCTGGCAAGAACTCGCTAACAACCCCCAACTTATGAGGACTGCTTTCCGCACGGCCATGGCCAAGCTCTCTGCCCTCGGTAACGACCGCAGCTCCCTAGTCGACTGCTCCTCCGTC
ATTCCCAACCCCGCTGCTGACGACACTGACCCCACCCTTCCTGGTGGCAAGGTCGCGGATGACATCGAAGGATCG
GTGAGCCAACTGTGGGCGTCTACGTGTGTGTTAGCTAACCGAGTT
CTCCGTGCAGTGCGCTGCTACTCCTTTCCCGGTGCTACCCATTGCGCCTGGGCCGACCCCCACCATCCCCGCTGTCGTCATCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGATTCGCTGCTCTAGTTTCCCTTGTCGCCGCTTCTGTTGCCATCGCAAGCCCTGCAACTCATCTCAAGAAGCGGGCCACATGCCCAGGAGGGCAGACTGTCGACGATGCACAGTGT
TGCGTCTGGTTCGATGTTTTGGATGACCTCCAAACCAACCT
GTTCAATGGCGCGAAGTGCGAGAACGGCGTTCACAAGGCGCTTCGTCTTCAGTTCCACGACTCCATCGGGTTTTCTCCT
GCTTTGACAGCAAGCGGCCAGTTCGG
TGGCGGAGGATCCGACGGTTCTATCATCGAGCATGATAACATCGAATTGACTTTCCCACCCAACGGAAACCTTGGAGGCATACCACACCTTCAT
CGTAAACCTAGGAGCCAACTAAACCGGCTGCGAAGGATCCAATTCGCCGCCGCCGCGGGGGTTGCTAACTGCCCAGGAGCTCCAAGGCTTGAGTTCCTCGCAGGAAGGCCCTTCACCTCT
CAGCCCTCCCCTCCTGGCCTTGTTCCTGGACCCGGAAACACTGTGACCCGTATCTTGGACCGCATGGCCGATGCAGGTTTTAGCGCCGACGAGACCGTAGATTTGTTGGCTTCGCACTCT
ATTGCCGCACAACAAGGGCTGAACGCTGCAATTGCA
GGCTCCCCATTCGACTCAACCCCCGATAGGTTCGACACCCAGTTCTTCATTGAGACCCTGCTTAAAGGTGTCTTGAACCCTGGA
CCGACTACCGGATTTGCTGAGGTCCTCTCTCCTCTTCCTGGAGAGTTCCGCATGCAGTCTGACTTCGCCATCGCTCGTGACCCTCG
CACTTCCTGCCGCTGGCAAGAACTCGCTAACAAC
CCCCAACTTATGAGGACTGCTTTCCGCACGGCCATGGCCAAGCTCTCTGCCCTCGGTAACGACCGCAGCTCCCTAGTCGACTGCTCCTCCGTCATTCCCAACCCCGCTGCTGACGACACT
GACCCCACCCTTCCTGGTGGCAAGGTCGCGGATGACATCGAAGGATCG
TGCGCTGCTACTCCTTTCCCGGTGCTACCCATTGCGCCTGGGCCGACCCCCACCATCCCCGCTGTCGTCATC
TAA

Retrieve as FASTA