Entry information : CnCcP02_grubiiH99
Entry ID 3859
Creation 2006-08-30 (Christophe Dunand)
Last sequence changes 2012-05-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-23 (Catherine Mathe (Scipio))
Peroxidase information: CnCcP02_grubiiH99
Name CnCcP02_grubiiH99
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Basidiomycota Tremellomycetes Tremellaceae Filobasidiella
Organism Cryptococcus neoformans (Filobasidiella neoformans)    [TaxId: 5207 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CnCcP02_grubiiH99
start..stop
S start..stop
CnCcP02_JEC21 664 0 1..334 1..334
CnCcP02_R265 639 0 1..334 1..334
CgaCcP02 599 0 1..334 1..341
DcryCcP02 521 0 1..312 1..310
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1079394..1079424 31 N° 2 1079480..1079555 76 N° 3 1079609..1079648 40 N° 4 1079710..1079729 20
N° 5 1079795..1079819 25 N° 6 1079883..1079979 97 N° 7 1080039..1080263 225 N° 8 1080312..1080345 34
N° 9 1080395..1080490 96 N° 10 1080546..1080594 49 N° 11 1080654..1080759 106 N° 12 1080822..1081027 206
join(1079394..1079424,1079480..1079555,1079609..1079648,1079710..1079729,1079795 ..1079819,1079883..1079979,1080039..1080263,1080312..1080345,1080395..1080490,10 80546..1080594,1080654..1080759,1080822..1081027)


exon

Literature and cross-references CnCcP02_grubiiH99
DNA ref. JGI genome:   cneoH99_Chr6 (1079394..1081027)
Cluster/Prediction ref. JGI gene:   1936 [Incorrect prediction]   9746 [Incorrect prediction]
Protein sequence: CnCcP02_grubiiH99
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334
PWM (Da):   %s   35989.89  
PI (pH):   %s   6.05
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASVKEGDYQALKEEIKKIMKQPGYDDGSAGPILVRLAWHASGNFSLVHNGGSNGAGMRFPPSVDPANAGLHHAISFLLPLQSANPWISHADLWTLAGITAIEAMGGPQIPWEPGRQDYESEQSAAEHRGDVSNRLPDGALGAAHIRDVFGRMGFSDQEIVALSGAHNLGRCHADRSGFDGPWVVNPTRFSNQYFKLLLRPIWKPRQWDGPFQYEAIVAGTRLMMLPTMALIEDPVFRPWVEKYAADQSLFFKDFANAFGKLIELGVDRDDTGFARLAKKAADEGKPLDKTTPPAGDGTCPVSGAVGGGVQRAAGGGGCPFMAMQKREAKL

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction fromm JGI. Variety="grubii", strain="H99".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCAGTAAAGGAAGGAGACTATCAAGGTGGGAGATAAGATCTATGGATGGAGAAGAATATCGATTAATTTTGTGTGATTAGCTCTGAAAGAGGAGATTAAAAAGATCATGAAGCA
GCCTGGGTACGACGATGGATCTGCTGGCCCAATTTTGGTTAG
GTATGTCAGGATTGCATGAGCCGTGATCCTTATATGCTTAACGGTACAAATAGACTGGCGTGGCATGCTTCTGGAAAC
TTTAGTCTGGTAGAA
GTAAGCTCACTCATTGCTGGTCGCGCTTTATTAGAGGTCTTAGCTAACATGTGATTCATAGCACAACGGAGGCTCGAACGGGTAAGCAAGGACTTCAAGCGTACA
ATGATACTCTTTACCTGGTCAAGCTAATATATGGAGTAAAGAGCTGGAATGAGGTTTCCACCAGAAGTGAGCATCAATGAATCATCTCAGCTTAACGCGCGAAGAACAAGACTAAAGCAA
CTTCTCCAGTCTGTTGACCCCGCAAATGCTGGTCTCCATCATGCCATATCGTTCCTTCTTCCGCTTCAGAGCGCCAACCCCTGGATCTCTCACGCGGACCTGTGGAGTATGTCCTCCTCT
CATCCTCAACTGTCACGGCTTCAATTAATCGACTCATTTTTTTAGCTCTGGCAGGAATAACAGCCATTGAGGCTATGGGCGGTCCGCAAATCCCCTGGGAACCTGGAAGACAAGACTATG
AATCTGAGCAATCTGCAGCTGAGCATCGAGGTGATGTGTCCAATCGTTTACCAGACGGAGCCTTGGGAGCAGCCCACATTAGAGACGTGTTTGGGAGAATGGGGTTCTCAGACCAGGAGA
TTGTAGCGCTCAGTGGTGCTCATAACCTGG
GTGAGTGGTGAGAGGTGGAAACATGTTTTTGATACTAACTCGGCTTAGGTCGCTGTCATGCGGACCGGAGTGGCTTTGATGGGTACTGAA
AGATAGTTTTTCAACGTGATGTTGGCTGATGAGCTATGCAGACCATGGGTGGTCAATCCTACACGCTTCTCCAACCAGTATTTCAAACTTCTCCTCCGTCCCATCTGGAAACCCAGACAA
TGGGATGGACCATTTCA
GTAGGTGGTTTCCAAACATAACTTCTTATAATCTGTGCTGACACGAGGATCGCAGGTATGAAGCTATTGTAGCCGGCACAAGGCTCATGATGCTCCCAACAGA
C
GTGAGTTTAATTTTCATCTCCATGACATCTGCATGATAACTTATTGACTCCTGTCATAGATGGCTCTCATTGAGGACCCAGTATTCCGTCCATGGGTTGAAAAATACGCCGCAGACCAA
AGTCTCTTCTTCAAAGATTTTGCCAACGCATTTGGTAAACTGATAG
GTATGCCTTCATCTTGATGCCGCTGCTACTGCTGGTTGCTGACTCTATTAACAATCGTTTAGAACTGGGAGTAG
ATAGGGACGATACAGGCTTTGCTCGACTGGCCAAAAAAGCGGCCGATGAGGGCAAGCCGTTGGACAAGACCACTCCTCCTGCCGGCGATGGGACTTGTCCCGTCTCTGGAGCAGTAGGCG
GTGGAGTGCAAAGAGCTGCTGGTGGTGGTGGCTGTCCCTTTATGGCGATGCAGAAAAGGGAGGCAAAGTTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCAGTAAAGGAAGGAGACTATCAAGCTCTGAAAGAGGAGATTAAAAAGATCATGAAGCAGCCTGGGTACGACGATGGATCTGCTGGCCCAATTTTGGTTAGACTGGCGTGGCAT
GCTTCTGGAAACTTTAGTCTGGTAGAA
CACAACGGAGGCTCGAACGGAGCTGGAATGAGGTTTCCACCAGAATCTGTTGACCCCGCAAATGCTGGTCTCCATCATGCCATATCGTTCCTT
CTTCCGCTTCAGAGCGCCAACCCCTGGATCTCTCACGCGGACCTGTGGA
CTCTGGCAGGAATAACAGCCATTGAGGCTATGGGCGGTCCGCAAATCCCCTGGGAACCTGGAAGACAAGAC
TATGAATCTGAGCAATCTGCAGCTGAGCATCGAGGTGATGTGTCCAATCGTTTACCAGACGGAGCCTTGGGAGCAGCCCACATTAGAGACGTGTTTGGGAGAATGGGGTTCTCAGACCAG
GAGATTGTAGCGCTCAGTGGTGCTCATAACCTGG
GTCGCTGTCATGCGGACCGGAGTGGCTTTGATGGACCATGGGTGGTCAATCCTACACGCTTCTCCAACCAGTATTTCAAACTTCTC
CTCCGTCCCATCTGGAAACCCAGACAATGGGATGGACCATTTCA
GTATGAAGCTATTGTAGCCGGCACAAGGCTCATGATGCTCCCAACAGACATGGCTCTCATTGAGGACCCAGTATTC
CGTCCATGGGTTGAAAAATACGCCGCAGACCAAAGTCTCTTCTTCAAAGATTTTGCCAACGCATTTGGTAAACTGATAG
AACTGGGAGTAGATAGGGACGATACAGGCTTTGCTCGACTG
GCCAAAAAAGCGGCCGATGAGGGCAAGCCGTTGGACAAGACCACTCCTCCTGCCGGCGATGGGACTTGTCCCGTCTCTGGAGCAGTAGGCGGTGGAGTGCAAAGAGCTGCTGGTGGTGGT
GGCTGTCCCTTTATGGCGATGCAGAAAAGGGAGGCAAAGTTATAA

Retrieve as FASTA