Entry information : GzCIIAA01
Entry ID 3887
Creation 2009-05-18 (Christophe Dunand)
Last sequence changes 2013-05-24 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-24 (Nizar Fawal)
Peroxidase information: GzCIIAA01
Name GzCIIAA01
Class Asco Class II type A    [Orthogroup: CIIAA001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Nectriaceae Gibberella
Organism Gibberella zeae (anamorph Fusarium graminearum)    [TaxId: 5518 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GzCIIAA01
start..stop
S start..stop
FoCIIAA 757 0 1..539 1..510
GmoCIIAA 719 0 1..539 1..510
CfioCIIAA01_MH18 384 4e-130 152..517 38..402
CfioCIIAA01_PJ7 384 7e-130 152..525 38..410
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8165362..8166604 1243 N° 2 8165177..8165278 102 N° 3 8164843..8165118 276  
complement(join(8164843..8165118,8165177..8165278,8165362..8166604))


exon

Literature and cross-references GzCIIAA01
Literature Gibberella zeae genome sequencing project
Protein ref. UniProtKB_Uniparc:   Q4IJQ7 [5' end]
DNA ref. JGI genome:   Supercontig_3.1 (8166604..8164843)
mRNA ref. GenBank:   XP_382727.1 [5' end]   XP_382726.1 [3' end]
Protein sequence: GzCIIAA01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   539 (518)
PWM (Da):   %s   57125.64 (55104.5)  
PI (pH):   %s   7.08 (7.07) Peptide Signal:   %s   cut: 22 range:22-539
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKFTVLIAAALAAAPIPEAAAHPGMGETIKEIERIAARSWGNGWGSNKWPSKNTGANTWGSGGGQSSGGQSSGGNAWGNGGGQTGGDQGNGGDSWSDSGSQSGGNSWSNGQSQNNGGGSSSWPGQSNGGSSWSSGGGQSGGQSGGQGGWTGDSFDAHSLIGDLSTVSDKSLTSVGRDIKKILQGNGNPTSRERYFGCPSMNTPQCKRDTCCVWQYISNELQERFRGEAGRCTRWARYAVRIGFHDAGTWSLKTASQGGGADGSIILANELTRGENKGLEQIGEYYQTVYDKYHNTYGFTQVTMADLIQMGSNIAAVTCPLGPRVRSFVGRKDSTKANLGGLLPKVTSDALTLINLFKDKTIGPDDLVALIGAHTTSQQYKGNIERDGDPQDTAGVWDILFYQQTLDExxxxxFYKFPSDEVLFPTPLSPMPAFEAFASGSSGQAAWNDYARAYVRLSLLGVNNINSLTECTKVLPQPVESYRHKDKGRFNKWLQSDDNSYTSKTVSKDIDDGYEISIPEDKIPSRRGPWKKWTTLFKWW

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (chromo 1, 2 introns). genomic sequence contains sequencing errors. Strain="PH-1 / NRRL 31084". No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAAGTTCACCGTCCTCATCGCGGCCGCTTTGGCCGCTGCTCCTATCCCAGAGGCTGCCGCCCACCCCGGTATGGGAGAAACCATCAAAGAAATCGAACGAATTGCTGCTCGAAGCTGGGG
AAATGGCTGGGGCAGCAACAAGTGGCCCTCCAAGAACACTGGAGCAAACACTTGGGGTAGCGGTGGAGGCCAGAGTAGTGGAGGCCAGAGCAGTGGAGGCAACGCATGGGGTAATGGAGG
AGGTCAGACTGGTGGAGACCAGGGCAATGGAGGCGACAGCTGGAGCGACAGTGGAAGTCAGAGCGGAGGCAACAGCTGGAGTAATGGCCAAAGCCAAAACAATGGAGGAGGCTCTTCCTC
CTGGCCCGGTCAGAGCAATGGCGGTAGCAGCTGGAGCAGCGGCGGAGGCCAAAGCGGAGGCCAGAGCGGAGGTCAGGGTGGCTGGACTGGAGACAGCTTCGATGCTCACTCCCTTATCGG
AGATCTTAGCACTGTCAGTGACAAGTCTCTCACTTCAGTCGGCAGGGATATCAAGAAGATCCTCCAAGGCAATGGCAACCCCACAAGCCGCGAGCGTTACTTTGGCTGCCCATCTATGAA
CACTCCCCAGTGCAAGCGCGACACCTGCTGTGTGTGGCAATACATCTCCAACGAGCTTCAAGAACGCTTCAGGGGTGAGGCTGGTCGCTGCACCCGATGGGCTCGCTATGCAGTTCGAAT
TGGCTTCCACGATGCTGGTACCTGGTCCTTGAAGACTGCTTCTCAGGGAGGTGGTGCTGATGGCTCCATCATCCTCGCCAATGAGCTGACCCGCGGCGAGAACAAGGGTCTTGAGCAGAT
TGGAGAGTACTACCAAACCGTCTACGACAAGTACCACAACACGTATGGCTTCACTCAGGTCACCATGGCCGATCTCATCCAGATGGGCTCCAACATTGCTGCTGTTACTTGTCCTCTTGG
ACCCCGAGTGCGCTCTTTTGTTGGTCGCAAGGATAGCACCAAGGCTAACTTGGGAGGACTCCTACCCAAAGTCACCTCTGATGCTCTCACTCTCATCAACTTGTTCAAGGACAAGACCAT
CGGCCCTGATGATCTTGTTGCTCTCATCGGTGCGCACACAACTTCTCAACAGCACAAAGGCAACATCGAGCGTGACGGTGATCCTCAGGACACCGCGTGAGNNGGTGTCTGGGATATTCT
GTTCTACCAGCAGACTCTCGACNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNTGTCTACAAGTTCCCTAGTGACGAGGTTCTCTTCCCAACACCCCTCTCACCAACGCCTGCCTTTGAAGCCTTTGCCAGTGGTAGCAGCGGCCAGGCTGCTTGGAACGAGGTAAGTTCC
AGCCATTTTCAGATATATCATTACCAGACAACTAACCCCATCTTAGGACTACGCCCGCGCCTACGTCCGTCTCAGTCTCTTGGGTGTCAACAACATCAACAGCCTTACCGAATGCACAAA
GGTTCTTCCTCAACCCGTCGAGTCTTACCGCCACAAGGACAAGGGTAGATTCAACAAGTGGCTCCAGAGTGACGACAACTCATACACATCCAAGACTGTTTCCAAGGATATCGACGATGG
TTATGAGATCTCTATTCCTGAGGACAAGATCCCTTCCAGACGTGGTCCTTGGAAGAAGTGGACCACTTTGTTCAAGTGGTGG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAAGTTCACCGTCCTCATCGCGGCCGCTTTGGCCGCTGCTCCTATCCCAGAGGCTGCCGCCCACCCCGGTATGGGAGAAACCATCAAAGAAATCGAACGAATTGCTGCTCGAAGCTGGGG
AAATGGCTGGGGCAGCAACAAGTGGCCCTCCAAGAACACTGGAGCAAACACTTGGGGTAGCGGTGGAGGCCAGAGTAGTGGAGGCCAGAGCAGTGGAGGCAACGCATGGGGTAATGGAGG
AGGTCAGACTGGTGGAGACCAGGGCAATGGAGGCGACAGCTGGAGCGACAGTGGAAGTCAGAGCGGAGGCAACAGCTGGAGTAATGGCCAAAGCCAAAACAATGGAGGAGGCTCTTCCTC
CTGGCCCGGTCAGAGCAATGGCGGTAGCAGCTGGAGCAGCGGCGGAGGCCAAAGCGGAGGCCAGAGCGGAGGTCAGGGTGGCTGGACTGGAGACAGCTTCGATGCTCACTCCCTTATCGG
AGATCTTAGCACTGTCAGTGACAAGTCTCTCACTTCAGTCGGCAGGGATATCAAGAAGATCCTCCAAGGCAATGGCAACCCCACAAGCCGCGAGCGTTACTTTGGCTGCCCATCTATGAA
CACTCCCCAGTGCAAGCGCGACACCTGCTGTGTGTGGCAATACATCTCCAACGAGCTTCAAGAACGCTTCAGGGGTGAGGCTGGTCGCTGCACCCGATGGGCTCGCTATGCAGTTCGAAT
TGGCTTCCACGATGCTGGTACCTGGTCCTTGAAGACTGCTTCTCAGGGAGGTGGTGCTGATGGCTCCATCATCCTCGCCAATGAGCTGACCCGCGGCGAGAACAAGGGTCTTGAGCAGAT
TGGAGAGTACTACCAAACCGTCTACGACAAGTACCACAACACGTATGGCTTCACTCAGGTCACCATGGCCGATCTCATCCAGATGGGCTCCAACATTGCTGCTGTTACTTGTCCTCTTGG
ACCCCGAGTGCGCTCTTTTGTTGGTCGCAAGGATAGCACCAAGGCTAACTTGGGAGGACTCCTACCCAAAGTCACCTCTGATGCTCTCACTCTCATCAACTTGTTCAAGGACAAGACCAT
CGGCCCTGATGATCTTGTTGCTCTCATCGGTGCGCACACAACTTCTCAACAGCACAAAGGCAACATCGAGCGTGACGGTGATCCTCAGGACACCGCGTGAGNNGGTGTCTGGGATATTCT
GTTCTACCAGCAGACTCTCGACNNNNNNNNNNNNNNNNNNNNN
TACAAGTTCCCTAGTGACGAGGTTCTCTTCCCAACACCCCTCTCACCAACGCCTGCCTTTGAAGCCTTTGCCAGTGG
TAGCAGCGGCCAGGCTGCTTGGAAC
GACTACGCCCGCGCCTACGTCCGTCTCAGTCTCTTGGGTGTCAACAACATCAACAGCCTTACCGAATGCACAAAGGTTCTTCCTCAACCCGTCGA
GTCTTACCGCCACAAGGACAAGGGTAGATTCAACAAGTGGCTCCAGAGTGACGACAACTCATACACATCCAAGACTGTTTCCAAGGATATCGACGATGGTTATGAGATCTCTATTCCTGA
GGACAAGATCCCTTCCAGACGTGGTCCTTGGAAGAAGTGGACCACTTTGTTCAAGTGGTGG

Retrieve as FASTA