Entry information : TvCIIBB02_IFO30340 (TvMnP02 / CVMNP)
Entry ID 3894
Creation 2006-09-21 (Filippo Passardi)
Last sequence changes 2012-10-31 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-10-31 (Christophe Dunand)
Peroxidase information: TvCIIBB02_IFO30340 (TvMnP02 / CVMNP)
Name (synonym) TvCIIBB02_IFO30340 (TvMnP02 / CVMNP)
Class Other class II peroxidase type B    [Orthogroup: CIIBB001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Trametes
Organism Trametes versicolor (Coriolus versicolor )    [TaxId: 5325 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TvCIIBB02_IFO30340
start..stop
S start..stop
TvCIIBB02 730 0 1..365 1..365
TvCIIBB02_PRL572 730 0 1..365 1..365
TvCIIBB02_KN9522 725 0 1..364 1..364
ParcCIIBB08 603 0 1..362 1..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 894..954 61 N° 2 1018..1225 208 N° 3 1287..1421 135 N° 4 1481..1923 443
N° 5 1985..2222 238 N° 6 2278..2290 13  
join(894..954,1018..1225,1287..1421,1481..1923,1985..2222,2278..2290)


exon

Literature and cross-references TvCIIBB02_IFO30340 (TvMnP02 / CVMNP)
Literature Iimura,Y. Isolation and characterization of the manganese peroxidase encoding gene from coriolus versicolor. Unpublished (12-JUL-1996)
Protein ref. UniProtKB:   Q9P3Z5
DNA ref. GenBank:   D86493.1
Protein sequence: TvCIIBB02_IFO30340 (TvMnP02 / CVMNP)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   366 (344)
PWM (Da):   %s   38592.04 (36374.8)  
PI (pH):   %s   4.09 (4.06) Peptide Signal:   %s   cut: 22 range:22-365
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKTLASLLSVLVTIQVASGALTRRVACPDGVNTATNAACCQLFAVRDDIQQNLFDGGECGEEVHESLRLTFHDAIGISPSIASRGQFGGGGADGSIALFEDIETNFHANLGVDEIIDEQRPFIARHNLTTADFIQFAGAIGVSNCPGAPQLDVFIGRPDATQPAPDLTVPEPFDTVDSIIERFSDAGGFTPAEIVALLVSHTIAAADHVDPSIPGTPFDSTPEEFDTQFFIETQLRGTLFPGTGGNQGEVESPLRGELRLQSDSELARDSRTACEWQSFNNQAKLQSAFKAAFRKMTVLGHDESLLIECSELVPTPPPATSVAHFPAGLSNADVEQACADTPFPTLPTDPGPVTTVAPVPPS

Retrieve as FASTA  
Remarks Complote sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAAACTCTCGCCTCTCTCCTCTCGGTTCTGGTCACCATCCAGGTCGCAAGCGGTGAGCGATAGCACGCAGTATTCTCTTCTACGACGTCATCCTGATATAGCCTTACTTGC
CTAGGCGCGCTCACCCGCCGTGTCGCCTGCCCCGACGGCGTGAACACCGCTACCAACGCGGCGTGCTGCCAGCTCTTCGCTGTCCGCGACGACATCCAGCAGAACCTGTTCGATGGCGGC
GAGTGTGGCGAGGAGGTCCACGAGTCCCTCCGTCTGACCTTCCACGACGCCATCGGCATCTCTCCTTCCATCGCCTCCCGCGGCCAATTCGG
GTAACTTCATATCTCCTCTGAGCCTCCA
TATCGTCAGATATCTAACATTGGTGCTTTGCAGGGGCGGAGGTGCCGACGGCTCCATCGCCCTCTTTGAGGACATCGAGACCAACTTCCACGCCAACCTCGGTGTCGACGAGATCATCGA
CGAGCAGCGGCCGTTCATCGCCCGCCACAACCTCACCACCGCCGACTT
GTTCGTGTCTTCCTCTGGCATCTAGCACAATGCCCTAAACACAACACTTTCTACCACAGCATCCAGTTCGCC
GGCGCCATCGGTGTCAGCAACTGCCCCGGCGCGCCCCAGCTGGACGTGTTCATCGGCCGCCCCGACGCGACGCAGCCCGCGCCCGACCTGACCGTGCCCGAGCCGTTCGACACCGTCGAC
AGCATCATCGAGCGGTTCTCCGACGCGGGCGGCTTCACGCCCGCGGAGATCGTCGCGCTTCTCGTGTCGCACACGATCGCCGCGGCCGACCACGTCGACCCGAGCATCCCCGGAACGCCC
TTCGACTCGACCCCGGAGGAGTTCGACACGCAGTTCTTCATCGAGACGCAGCTCCGCGGCACGCTCTTCCCCGGCACCGGCGGCAACCAGGGCGAGGTCGAGTCCCCCCTCCGCGGCGAG
CTGCGCCTCCAGTCCGACTCTGAGCTCGCGCGCGACTCTCGCACTGCTTGCGAGTGGCAGTCCTTCGTCA
GTGCGTACCTCTTCCTCTCGCCTCTTGATGTGCAGAGCGATACTGACGCG
TGGGAACGCAGACAACCAGGCCAAGCTCCAGTCCGCGTTCAAGGCTGCCTTCCGCAAGATGACCGTGCTCGGCCACGACGAGAGCCTGCTGATCGAGTGCTCCGAGCTCGTGCCCACGCC
TCCGCCGGCGACGAGCGTCGCGCACTTCCCCGCTGGGCTCAGCAACGCCGACGTCGAGCAGGCGTGCGCCGACACCCCCTTCCCGACGCTCCCCACCGACCCTGGACCCGTCACCACCGT
CGCCCCCGT
GTAAGTGCCTGATCACTCGAGTATCGCGGCACGACGCTGACTTGTTGCCTTGCAGCCCCCCGTCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAAACTCTCGCCTCTCTCCTCTCGGTTCTGGTCACCATCCAGGTCGCAAGCGGCGCGCTCACCCGCCGTGTCGCCTGCCCCGACGGCGTGAACACCGCTACCAACGCGGCG
TGCTGCCAGCTCTTCGCTGTCCGCGACGACATCCAGCAGAACCTGTTCGATGGCGGCGAGTGTGGCGAGGAGGTCCACGAGTCCCTCCGTCTGACCTTCCACGACGCCATCGGCATCTCT
CCTTCCATCGCCTCCCGCGGCCAATTCGG
GGGCGGAGGTGCCGACGGCTCCATCGCCCTCTTTGAGGACATCGAGACCAACTTCCACGCCAACCTCGGTGTCGACGAGATCATCGACGAG
CAGCGGCCGTTCATCGCCCGCCACAACCTCACCACCGCCGACTT
CATCCAGTTCGCCGGCGCCATCGGTGTCAGCAACTGCCCCGGCGCGCCCCAGCTGGACGTGTTCATCGGCCGCCCC
GACGCGACGCAGCCCGCGCCCGACCTGACCGTGCCCGAGCCGTTCGACACCGTCGACAGCATCATCGAGCGGTTCTCCGACGCGGGCGGCTTCACGCCCGCGGAGATCGTCGCGCTTCTC
GTGTCGCACACGATCGCCGCGGCCGACCACGTCGACCCGAGCATCCCCGGAACGCCCTTCGACTCGACCCCGGAGGAGTTCGACACGCAGTTCTTCATCGAGACGCAGCTCCGCGGCACG
CTCTTCCCCGGCACCGGCGGCAACCAGGGCGAGGTCGAGTCCCCCCTCCGCGGCGAGCTGCGCCTCCAGTCCGACTCTGAGCTCGCGCGCGACTCTCGCACTGCTTGCGAGTGGCAGTCC
TTCGTCA
ACAACCAGGCCAAGCTCCAGTCCGCGTTCAAGGCTGCCTTCCGCAAGATGACCGTGCTCGGCCACGACGAGAGCCTGCTGATCGAGTGCTCCGAGCTCGTGCCCACGCCTCCG
CCGGCGACGAGCGTCGCGCACTTCCCCGCTGGGCTCAGCAACGCCGACGTCGAGCAGGCGTGCGCCGACACCCCCTTCCCGACGCTCCCCACCGACCCTGGACCCGTCACCACCGTCGCC
CCCGT
CCCCCCGTCGTAA

Retrieve as FASTA