Entry information : TaPrx114-1A (TAPOX4)
Entry ID 39
Creation 2006-07-13 (Christophe Dunand)
Last sequence changes 2006-07-13 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-06-18 (Christophe Dunand)
Peroxidase information: TaPrx114-1A (TAPOX4)
Name (synonym) TaPrx114-1A (TAPOX4)
Class Class III peroxidase    [Orthogroup: Prx080]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Triticum
Organism Triticum aestivum (bread wheat)    [TaxId: 4565 ]
Cellular localisation N/D
Tissue types Leaves
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TaPrx114-1A
start..stop
S start..stop
AvePrx114-1A 646 0 1..319 1..319
HvPrx33 534 0 45..319 1..275
AvePrx114-1B 535 0 28..319 30..321
AvePrx114-1C 534 0 27..319 29..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 212..421 210 N° 2 921..1112 192 N° 3 1198..1755 558  
join(212..421,921..1112,1198..1755)


exon

Literature and cross-references TaPrx114-1A (TAPOX4)
Literature Baga,M., Chibbar,R.N. and Kartha,K.K. Molecular cloning and expression analysis of peroxidase genes from wheat. Plant Mol. Biol. 29 (4), 647-662 (1995)
Protein ref. UniProtKB:   Q43220
DNA ref. GenBank:   X85230.1
Protein sequence: TaPrx114-1A (TAPOX4)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (296)
PWM (Da):   %s   33478.72 (31246.6)  
PI (pH):   %s   8.49 (8.58) Peptide Signal:   %s   cut: 24 range:24-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMAMASSLSVLLLLCLAAPSSAQLSPRFYARSCPRAQAIIRRGVAAAVRSERRMGASLLRLHFHDCFVQGCDASILLSDTATFTGEQGAGPNAGSIRGMNVIDNIKAQVEAVCTQTVSCADILAVAARDSVVALGGPSWTVPLGRRDSTTASLSLANSDLPPPSFDVANLTANFAAKGLSVTDMVALSGAHTIGQAQCQNFRDRLYNETNIDTAFATSLRANCPRPTGSGDSSLAPLDTTTPNAFDNAYYRNLMSQKGLLHSDQVLINDGRTAGLVRTYSSASAQFNRDFRAAMVSMGNISPLTGTQGQVRLSCSRVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAATGGCAATGGCCTCTTCTCTGTCGGTGCTGTTGCTCCTGTGCCTGGCGGCACCGTCCTCGGCGCAGCTTTCGCCTAGGTTCTACGCTAGGTCGTGCCCGAGGGCGCAGGCCATC
ATCAGGAGGGGTGTGGCGGCCGCCGTGAGGAGTGAGCGCCGCATGGGAGCGTCGCTGCTCCGGCTGCATTTCCACGACTGCTTTGTCCAA
GCAAGTCCCTCACGCCTTCTCTCTTTACTT
AATGTAGTTTCTACTGCATACACTGCTGCTAATCTCTCTAATTCCAATTAATTGTCGTTGATTTAGTAGACTGGAGGGAGTACTTAATTTAGAAGGTCTCAGTTTAAACTGTAGTCAAAG
TCATTACATTGTCAAAAAGTTAATGGAGTGGATCTACATGTGTACCTAACTACTGATAAGTTGACACTCTTTAGATCGATAATCAACGACATCTTAATTTAGAAGGTCTCAGTTTAAACT
GTAGTCAAAGTCATCCATGTTGCCCCGCTACGTAAATCACGTAAGTTGTTTTATGTAGATGTAGCAATACTCCTCTTTAGACTCTTCACTTGACAGTGACTTTCCAACTTATTTTTTACT
TGGCACTTTGACAGTGACTTTTCAGTTGAAATCAACTAACGGAACTAGAATGTACCGAATCTATGTTGACGGAAGTAATTTCTTATGTGTGTGACGATCGATGCATCAGGGCTGCGACGC
GTCCATACTGCTGAGCGACACGGCCACCTTCACCGGCGAGCAGGGGGCAGGTCCGAACGCCGGCTCCATTCGAGGCATGAACGTCATCGACAACATCAAGGCGCAGGTCGAGGCCGTGTG
CACGCAGACTGTCTCCTGCGCCGACATCCTCGCCGTCGCGGCCCGAGACTCAGTCGTCGCC
GTAAGATCGATCCAGGCCATTGTAGTTAATTTGCTCGACAGTAAATTAAGAAACTTAGT
AGTAGTTCTTTATTATTTGCTTGCAGCTGGGAGGGCCTTCGTGGACCGTTCCTCTGGGGAGGAGGGACTCGACGACGGCGAGCTTGTCGCTGGCCAACAGCGACCTGCCGCCGCCGTCCT
TCGACGTGGCCAACCTCACTGCCAACTTTGCCGCCAAGGGGCTCAGCGTGACGGACATGGTCGCCCTCTCTGGCGCGCACACCATCGGGCAGGCGCAGTGCCAGAACTTCCGGGACAGGC
TCTACAACGAGACCAACATCGATACGGCCTTCGCAACATCTCTCAGGGCCAACTGCCCACGGCCGACCGGGTCCGGCGACAGCAGCCTGGCACCGCTGGACACGACGACGCCCAACGCGT
TCGACAACGCATACTACCGCAACCTGATGTCACAGAAGGGGCTCCTGCACTCCGACCAGGTTCTGATCAACGACGGACGCACCGCGGGACTTGTCCGGACATACTCGTCGGCGTCGGCGC
AGTTCAACAGGGACTTCAGGGCGGCCATGGTGAGCATGGGGAACATCAGCCCGCTCACCGGGACGCAGGGGCAGGTCAGGCTCAGCTGCTCCAGGGTGAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAATGGCAATGGCCTCTTCTCTGTCGGTGCTGTTGCTCCTGTGCCTGGCGGCACCGTCCTCGGCGCAGCTTTCGCCTAGGTTCTACGCTAGGTCGTGCCCGAGGGCGCAGGCCATC
ATCAGGAGGGGTGTGGCGGCCGCCGTGAGGAGTGAGCGCCGCATGGGAGCGTCGCTGCTCCGGCTGCATTTCCACGACTGCTTTGTCCAA
GGCTGCGACGCGTCCATACTGCTGAGCGAC
ACGGCCACCTTCACCGGCGAGCAGGGGGCAGGTCCGAACGCCGGCTCCATTCGAGGCATGAACGTCATCGACAACATCAAGGCGCAGGTCGAGGCCGTGTGCACGCAGACTGTCTCCTGC
GCCGACATCCTCGCCGTCGCGGCCCGAGACTCAGTCGTCGCC
CTGGGAGGGCCTTCGTGGACCGTTCCTCTGGGGAGGAGGGACTCGACGACGGCGAGCTTGTCGCTGGCCAACAGCGAC
CTGCCGCCGCCGTCCTTCGACGTGGCCAACCTCACTGCCAACTTTGCCGCCAAGGGGCTCAGCGTGACGGACATGGTCGCCCTCTCTGGCGCGCACACCATCGGGCAGGCGCAGTGCCAG
AACTTCCGGGACAGGCTCTACAACGAGACCAACATCGATACGGCCTTCGCAACATCTCTCAGGGCCAACTGCCCACGGCCGACCGGGTCCGGCGACAGCAGCCTGGCACCGCTGGACACG
ACGACGCCCAACGCGTTCGACAACGCATACTACCGCAACCTGATGTCACAGAAGGGGCTCCTGCACTCCGACCAGGTTCTGATCAACGACGGACGCACCGCGGGACTTGTCCGGACATAC
TCGTCGGCGTCGGCGCAGTTCAACAGGGACTTCAGGGCGGCCATGGTGAGCATGGGGAACATCAGCCCGCTCACCGGGACGCAGGGGCAGGTCAGGCTCAGCTGCTCCAGGGTGAACTAA

Retrieve as FASTA